Recombinant Human PANK1 Protein, GST-tagged

Cat.No. : PANK1-34H
Product Overview : Recombinant Human PANK1(310 a.a. - 409 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 310 a.a. - 409 a.a.
Description : This gene encodes a member of the pantothenate kinase family. Pantothenate kinases are key regulatory enzymes in the biosynthesis of coenzyme A (CoA). The encoded protein catalyzes the first and rate-limiting enzymatic reaction in CoA biosynthesis and is regulated by CoA through feedback inhibition. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. This gene and an intronic miRNA on the same strand are co-regulated by the tumor suppressor p53 (see PMID 20833636).
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : IRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDFRMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name PANK1 pantothenate kinase 1 [ Homo sapiens ]
Official Symbol PANK1
Synonyms PANK1; pantothenate kinase 1; PANK, pantothenate kinase; MGC24596; PANK1a; PANK1b; pantothenic acid kinase 1; PANK;
Gene ID 53354
mRNA Refseq NM_148977
Protein Refseq NP_683878
MIM 606160
UniProt ID Q8TE04

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PANK1 Products

Required fields are marked with *

My Review for All PANK1 Products

Required fields are marked with *

0
cart-icon
0
compare icon