Recombinant Human PANK1 Protein, GST-tagged
Cat.No. : | PANK1-34H |
Product Overview : | Recombinant Human PANK1(310 a.a. - 409 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 310 a.a. - 409 a.a. |
Description : | This gene encodes a member of the pantothenate kinase family. Pantothenate kinases are key regulatory enzymes in the biosynthesis of coenzyme A (CoA). The encoded protein catalyzes the first and rate-limiting enzymatic reaction in CoA biosynthesis and is regulated by CoA through feedback inhibition. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. This gene and an intronic miRNA on the same strand are co-regulated by the tumor suppressor p53 (see PMID 20833636). |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | IRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDFRMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Gene Name | PANK1 pantothenate kinase 1 [ Homo sapiens ] |
Official Symbol | PANK1 |
Synonyms | PANK1; pantothenate kinase 1; PANK, pantothenate kinase; MGC24596; PANK1a; PANK1b; pantothenic acid kinase 1; PANK; |
Gene ID | 53354 |
mRNA Refseq | NM_148977 |
Protein Refseq | NP_683878 |
MIM | 606160 |
UniProt ID | Q8TE04 |
◆ Recombinant Proteins | ||
PANK1-32H | Recombinant Human PANK1, MYC/DDK-tagged | +Inquiry |
PANK1-33H | Recombinant Human PANK1 Protein, GST-tagged | +Inquiry |
PANK1-1541HF | Recombinant Full Length Human PANK1 Protein, GST-tagged | +Inquiry |
Pank1-8019M | Recombinant Mouse Pank1 protein, His & T7-tagged | +Inquiry |
PANK1-12333M | Recombinant Mouse PANK1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PANK1-1278HCL | Recombinant Human PANK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PANK1 Products
Required fields are marked with *
My Review for All PANK1 Products
Required fields are marked with *