Recombinant Human papillomavirus 31 L1 Protein, His-tagged
| Cat.No. : | L1-44H |
| Product Overview : | Recombinant Human papillomavirus 31 L1 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human papillomavirus 31 |
| Source : | E.coli |
| Tag : | His |
| Description : | major capsid L1 protein |
| Form : | PBS, 0.05%SKL, pH7.4. |
| Molecular Mass : | 57 kDa |
| AA Sequence : | MSLWRPSEATVYLPPVPVSKVVSTDEYVTRTNIYYHAGSARLLTVGHPYYSIPKSDNPKKIVVPKVSGLQYRVFRVRLPDPNKFGFPDTSFYNPETQRLVWACVGLEVGRGQPLGVGISGHPLLNKFDDTENSNRYAGGPGTDNRECISMDYKQTQLCLLGCKPPIGEHWGKGSPCSNNAITPGDCPPLELKNSVIQDGDMVDTGFGAMDFTALQDTKSNVPLDICNSICKYPDYLKMVAEPYGDTLFFYLRREQMFVRHFFNRSGTVGESVPTDLYIKGSGSTATLANSTYFPTPSGSMVTSDAQIFNKPYWMQRAQGHNNGICWGNQLFVTVVDTTRSTNMSVCAAIANSDTTFKSSNFKEYLRHGEEFDLQFIFQLCKITLSADIMTYIHSMNPAILEDWNFGLTTPPSGSLEDTYRFVTSQAITCQKTAPQKPKEDPFKDYVFWEVNLKEKFSADLDQFPLGRKFLLQAGYRARPKFKAGKRSAPSASTTTPAKRKKTKKHHHHHHHH |
| Endotoxin : | ＜1EU/ug |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.05 mg/ml |
| Gene Name | L1 L1 [ Human papillomavirus ] |
| Official Symbol | L1 |
| Synonyms | AMQ97_gp6 |
| Gene ID | 25479185 |
| Protein Refseq | YP_009163896 |
| UniProt ID | P17388 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All L1 Products
Required fields are marked with *
My Review for All L1 Products
Required fields are marked with *
Recently Viewed
