Recombinant Human papillomavirus 58 L1 Protein, His-tagged

• Cat.No.: L1-47H
• Product Overview: Recombinant Human papillomavirus 58 L1 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Human papillomavirus 58
• Source: E.coli
• Tag: His
• Description: major capsid L1 protein
• Form: PBS, 0.05%SKL, pH7.4
• Molecular Mass: 57.5 kDa
• AA Sequence: MQMSVWRPSEATVYLPPVPVSKVVSTDEYVSRTSIYYYAGSSRLLAVGNPYFSIKSPNNNKKVLVPKVSGLQYRVFRVRLPDPNKFGFPDTSFYNPDTQRLVWACVGLEIGRGQPLGVGVSGHPYLNKFDDTETSNRYPAQPGSDNRECLSMDYKQTQLCLIGCKPPTGEHWGKGVACNNNAAATDCPPLELFNSIIEDGDMVDTGFGCMDFGTLQANKSDVPIDICNSTCKYPDYLKMASEPYGDSLFFFLRREQMFVRHFFNRAGKLGEAVPDDLYIKGSGNTAVIQSSAFFPTPSGSIVTSESQLFNKPYWLQRAQGHNNGICWGNQLFVTVVDTTRSTNMTLCTEVTKEGTYKNDNFKEYVRHVEEYDLQFVFQLCKITLTAEIMTYIHTMDSNILEDWQFGLTPPPSASLQDTYRFVTSQAITCQKTAPPKEKEDPLNKYTFWEVNLKEKFSADLDQFPLGRKFLLQSGLKAKPRLKRSAPTTRAPSTKRKKVKKHHHHHHHH
• Endotoxin: ＜1EU/ug
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.2 mg/ml

Gene Information

• Gene Name: L1 major capsid L1 protein [ Human papillomavirus type 53 ]
• Official Symbol: L1
• Synonyms: HpV53gp7
• Gene ID: 1489468
• Protein Refseq: NP_041848
• UniProt ID: P26535