Recombinant Human papillomavirus type 16 E7 protein, His-tagged
| Cat.No. : | E7-4258H |
| Product Overview : | Recombinant Human papillomavirus type 16 E7 protein(P03129)(1-98aa), fused to N-terminal His tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human papillomavirus type 16 |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-98aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 15 kDa |
| AA Sequence : | MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| E7-4258H | Recombinant Human papillomavirus type 16 E7 protein, His-tagged | +Inquiry |
| E7-1694H | Recombinant HPV-6 E7 Protein, His tagged | +Inquiry |
| E7-1693H | Recombinant HPV-53 E7 Protein | +Inquiry |
| E7-1690H | Recombinant HPV-26 E7 Protein | +Inquiry |
| E7-5722H | Recombinant Human papillomavirus type 16 E7 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All E7 Products
Required fields are marked with *
My Review for All E7 Products
Required fields are marked with *
