Recombinant Human papillomavirus type 18 L1 Protein, His-tagged
| Cat.No. : | L1-43H |
| Product Overview : | Recombinant Human papillomavirus type 18 L1 Protein, fused to His-tag, was expressed in E. coli. |
| Availability | February 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human papillomavirus type 18 |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 51-568 a.a. |
| Description : | major capsid L1 protein |
| Form : | PBS, 0.05%SKL, pH7.4. |
| Molecular Mass : | 58.9 kDa |
| AA Sequence : | MRNVNVFPIFLQMALWRPSDNTVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPAKRVRVRARKHHHHHHHH |
| Endotoxin : | <1EU/ug |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.4 mg/ml |
| Gene Name | L1 major capsid L1 protein [ Alphapapillomavirus 7 ] |
| Official Symbol | L1 |
| Synonyms | HpV18gp8 |
| Gene ID | 1489090 |
| Protein Refseq | NP_040317 |
| UniProt ID | P06794 |
| ◆ Recombinant Proteins | ||
| L1-1723H | Recombinant HPV-34 L1 Protein | +Inquiry |
| HPV16-L1-09H | Recombinant HPV16 L1 Protein | +Inquiry |
| L1-1722H | Recombinant HPV-26 L1 Protein | +Inquiry |
| L1-354 | Recombinant HPV18 L1 protein, GST-tagged | +Inquiry |
| L1-45H | Recombinant Human papillomavirus 33 L1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All L1 Products
Required fields are marked with *
My Review for All L1 Products
Required fields are marked with *
