Recombinant Human PAPSS2 protein, GST-tagged
| Cat.No. : | PAPSS2-6743H | 
| Product Overview : | Recombinant Human PAPSS2 protein(1-333 aa), fused with N-terminal GST tag, was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 1-333 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| AA Sequence : | MSGIKKQKTENQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTNLSTVSDCVHQVVELLQEQNIVPYTIIKDIHELFVPENKLDHVRAEAETLPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQVMHFDTLLDDGVINMSIPIVLPVSAEDKTRLEGCSKFVLAHGGRRVAILRDAEF | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Official Symbol | PAPSS2 | 
| Synonyms | PAPSS2; 3-phosphoadenosine 5-phosphosulfate synthase 2; bifunctional 3-phosphoadenosine 5-phosphosulfate synthase 2; ATPSK2; SK 2; PAPSS 2; PAPS synthase 2; PAPS synthetase 2; ATP sulfurylase/APS kinase 2; ATP sulfurylase/adenosine 5-phosphosulfate kinase; 3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2; bifunctional 3-phosphoadenosine 5-phosphosulfate synthethase 2; SK2; | 
| Gene ID | 9060 | 
| mRNA Refseq | NM_001015880 | 
| Protein Refseq | NP_001015880 | 
| MIM | 603005 | 
| UniProt ID | O95340 | 
| ◆ Recombinant Proteins | ||
| PAPSS2-5274H | Recombinant Human PAPSS2 Protein (Met1-Asn614), C-His tagged | +Inquiry | 
| PAPSS2-3299R | Recombinant Rhesus monkey PAPSS2 Protein, His-tagged | +Inquiry | 
| Papss2-4675M | Recombinant Mouse Papss2 Protein, Myc/DDK-tagged | +Inquiry | 
| PAPSS2-32H | Recombinant Human PAPSS2, His-tagged | +Inquiry | 
| PAPSS2-1524H | Recombinant Human PAPSS2 protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| PAPSS2-3440HCL | Recombinant Human PAPSS2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All PAPSS2 Products
Required fields are marked with *
My Review for All PAPSS2 Products
Required fields are marked with *
  
        
    
      
            