Recombinant Human PARP11 protein, His-tagged
Cat.No. : | PARP11-3319H |
Product Overview : | Recombinant Human PARP11 protein(Q9NR21)(2-331aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-331aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41 kDa |
AA Sequence : | FHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PARP11 poly (ADP-ribose) polymerase family, member 11 [ Homo sapiens ] |
Official Symbol | PARP11 |
Synonyms | PARP11; poly (ADP-ribose) polymerase family, member 11; C12orf6, chromosome 12 open reading frame 6; poly [ADP-ribose] polymerase 11; MIB006; PARP-11; C12orf6; DKFZp779H0122; |
Gene ID | 57097 |
mRNA Refseq | NM_020367 |
Protein Refseq | NP_065100 |
UniProt ID | Q9NR21 |
◆ Recombinant Proteins | ||
PARP11-3319H | Recombinant Human PARP11 protein, His-tagged | +Inquiry |
PARP11-26352TH | Recombinant Human PARP11 | +Inquiry |
PARP11-431H | Recombinant Human PARP11, GST-tagged | +Inquiry |
PARP11-3307R | Recombinant Rhesus monkey PARP11 Protein, His-tagged | +Inquiry |
PARP11-12369M | Recombinant Mouse PARP11 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PARP11-3429HCL | Recombinant Human PARP11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PARP11 Products
Required fields are marked with *
My Review for All PARP11 Products
Required fields are marked with *
0
Inquiry Basket