Recombinant Human PARP14 protein, His&Myc-tagged
Cat.No. : | PARP14-4457H |
Product Overview : | Recombinant Human PARP14 protein(Q460N5)(1605-1801aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1605-1801aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.0 kDa |
AA Sequence : | IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | PARP14 poly (ADP-ribose) polymerase family, member 14 [ Homo sapiens ] |
Official Symbol | PARP14 |
Synonyms | PARP14; poly (ADP-ribose) polymerase family, member 14; poly [ADP-ribose] polymerase 14; KIAA1268; pART8; collaborator of STAT6; B-aggressive lymphoma 2; b aggressive lymphoma protein 2; BAL2; PARP-14; |
Gene ID | 54625 |
mRNA Refseq | NM_017554 |
Protein Refseq | NP_060024 |
MIM | 610028 |
UniProt ID | Q460N5 |
◆ Recombinant Proteins | ||
PARP14-6504M | Recombinant Mouse PARP14 Protein, His (Fc)-Avi-tagged | +Inquiry |
PARP14-0079H | Recombinant Human PARP14 Protein (F1208-E1387), His/Strep tagged | +Inquiry |
PARP14-5939H | Recombinant Human PARP14 protein, hFc-tagged | +Inquiry |
PARP14-0078H | Recombinant Human PARP14 Protein (F1208-E1387), Tag Free | +Inquiry |
PARP14-12371M | Recombinant Mouse PARP14 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PARP14 Products
Required fields are marked with *
My Review for All PARP14 Products
Required fields are marked with *
0
Inquiry Basket