Recombinant Human PARP9 protein, His-tagged

Cat.No. : PARP9-4458H
Product Overview : Recombinant Human PARP9 protein(Q8IXQ6)(628-854aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 628-854aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 30.0 kDa
AA Sequence : IQQQKTQDEMKENIIFLKCPVPPTQELLDQKKQFEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGFFCQGHPLNIVPPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFAQHPWRGFASGSPVD
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name PARP9 poly (ADP-ribose) polymerase family, member 9 [ Homo sapiens ]
Official Symbol PARP9
Synonyms PARP9; poly (ADP-ribose) polymerase family, member 9; poly [ADP-ribose] polymerase 9; BAL; BAL1; PARP-9; b aggressive lymphoma protein; poly (ADP-ribose) polymerase 9; MGC:7868; FLJ26637; FLJ35310; FLJ41418; FLJ43593; DKFZp666B0810; DKFZp686M15238;
Gene ID 83666
mRNA Refseq NM_001146102
Protein Refseq NP_001139574
MIM 612065
UniProt ID Q8IXQ6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PARP9 Products

Required fields are marked with *

My Review for All PARP9 Products

Required fields are marked with *

0
cart-icon
0
compare icon