Recombinant Human PARP9 protein, His-tagged
| Cat.No. : | PARP9-4458H |
| Product Overview : | Recombinant Human PARP9 protein(Q8IXQ6)(628-854aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 628-854aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.0 kDa |
| AA Sequence : | IQQQKTQDEMKENIIFLKCPVPPTQELLDQKKQFEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGFFCQGHPLNIVPPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFAQHPWRGFASGSPVD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | PARP9 poly (ADP-ribose) polymerase family, member 9 [ Homo sapiens ] |
| Official Symbol | PARP9 |
| Synonyms | PARP9; poly (ADP-ribose) polymerase family, member 9; poly [ADP-ribose] polymerase 9; BAL; BAL1; PARP-9; b aggressive lymphoma protein; poly (ADP-ribose) polymerase 9; MGC:7868; FLJ26637; FLJ35310; FLJ41418; FLJ43593; DKFZp666B0810; DKFZp686M15238; |
| Gene ID | 83666 |
| mRNA Refseq | NM_001146102 |
| Protein Refseq | NP_001139574 |
| MIM | 612065 |
| UniProt ID | Q8IXQ6 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PARP9 Products
Required fields are marked with *
My Review for All PARP9 Products
Required fields are marked with *




