Recombinant Human PAX5 protein, His&Myc-tagged
Cat.No. : | PAX5-3663H |
Product Overview : | Recombinant Human PAX5 protein(Q02548)(1-391aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-391aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.2 kDa |
AA Sequence : | MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PAX5 paired box 5 [ Homo sapiens ] |
Official Symbol | PAX5 |
Synonyms | PAX5; paired box 5; paired box gene 5 (B cell lineage specific activator protein) , paired box gene 5 (B cell lineage specific activator); paired box protein Pax-5; B cell lineage specific activator; BSAP; paired box homeotic gene 5; transcription factor PAX 5; B cell specific activator protein; B-cell lineage specific activator; B-cell-specific transcription factor; |
Gene ID | 5079 |
mRNA Refseq | NM_016734 |
Protein Refseq | NP_057953 |
MIM | 167414 |
UniProt ID | Q02548 |
◆ Recombinant Proteins | ||
PAX5-5994C | Recombinant Chicken PAX5 | +Inquiry |
PAX5-199H | Recombinant Human paired box 5 Protein, His&Flag&StrepII tagged | +Inquiry |
Pax5-4686M | Recombinant Mouse Pax5 Protein, Myc/DDK-tagged | +Inquiry |
PAX5-2551H | Recombinant Human PAX5 Protein, His-tagged | +Inquiry |
PAX5-3759H | Recombinant Human PAX5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAX5-3416HCL | Recombinant Human PAX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAX5 Products
Required fields are marked with *
My Review for All PAX5 Products
Required fields are marked with *