Recombinant Human PBK Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PBK-1788H
Product Overview : PBK MS Standard C13 and N15-labeled recombinant protein (NP_060962) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a serine/threonine protein kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. The encoded protein may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. Overexpression of this gene has been implicated in tumorigenesis. Alternative splicing results in multiple transcript variants.
Molecular Mass : 36.1 kDa
AA Sequence : MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PBK PDZ binding kinase [ Homo sapiens (human) ]
Official Symbol PBK
Synonyms PBK; PDZ binding kinase; lymphokine-activated killer T-cell-originated protein kinase; cancer/testis antigen 84; CT84; FLJ14385; Nori 3; SPK; T LAK cell originated protein kinase; TOPK; PDZ-binding kinase; MAPKK-like protein kinase; serine/threonine protein kinase; T-LAK cell-originated protein kinase; spermatogenesis-related protein kinase; Nori-3;
Gene ID 55872
mRNA Refseq NM_018492
Protein Refseq NP_060962
MIM 611210
UniProt ID Q96KB5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PBK Products

Required fields are marked with *

My Review for All PBK Products

Required fields are marked with *

0
cart-icon