Recombinant Human PBK protein, T7/His-tagged

Cat.No. : PBK-229H
Product Overview : Recombinant human PBK cDNA (2 – 322 aa, derived from BC015191) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 2-322 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVY LMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKS LNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENM TVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYY AALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name PBK PDZ binding kinase [ Homo sapiens ]
Official Symbol PBK
Synonyms PBK; PDZ binding kinase; lymphokine-activated killer T-cell-originated protein kinase; cancer/testis antigen 84; CT84; FLJ14385; Nori 3; SPK; T LAK cell originated protein kinase; TOPK; PDZ-binding kinase; MAPKK-like protein kinase; serine/threonine protein kinase; T-LAK cell-originated protein kinase; spermatogenesis-related protein kinase; Nori-3;
Gene ID 55872
mRNA Refseq NM_018492
Protein Refseq NP_060962
MIM 611210
UniProt ID Q96KB5
Chromosome Location 8p21.2
Function ATP binding; nucleotide binding; protein binding; protein serine/threonine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PBK Products

Required fields are marked with *

My Review for All PBK Products

Required fields are marked with *

0
cart-icon