Recombinant Human PBK protein, T7/His-tagged
| Cat.No. : | PBK-229H |
| Product Overview : | Recombinant human PBK cDNA (2 – 322 aa, derived from BC015191) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 2-322 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVY LMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKS LNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENM TVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYY AALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | PBK PDZ binding kinase [ Homo sapiens ] |
| Official Symbol | PBK |
| Synonyms | PBK; PDZ binding kinase; lymphokine-activated killer T-cell-originated protein kinase; cancer/testis antigen 84; CT84; FLJ14385; Nori 3; SPK; T LAK cell originated protein kinase; TOPK; PDZ-binding kinase; MAPKK-like protein kinase; serine/threonine protein kinase; T-LAK cell-originated protein kinase; spermatogenesis-related protein kinase; Nori-3; |
| Gene ID | 55872 |
| mRNA Refseq | NM_018492 |
| Protein Refseq | NP_060962 |
| MIM | 611210 |
| UniProt ID | Q96KB5 |
| Chromosome Location | 8p21.2 |
| Function | ATP binding; nucleotide binding; protein binding; protein serine/threonine kinase activity; |
| ◆ Recombinant Proteins | ||
| PBK-377H | Recombinant Human PDZ Binding Kinase, His-tagged | +Inquiry |
| PBK-0818H | Recombinant Human PBK Protein (M1-V322), Tag Free | +Inquiry |
| PBK-6522M | Recombinant Mouse PBK Protein, His (Fc)-Avi-tagged | +Inquiry |
| PBK-0819H | Recombinant Human PBK Protein (M1-V322), GST tagged | +Inquiry |
| PBK-12400M | Recombinant Mouse PBK Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PBK-713HCL | Recombinant Human PBK cell lysate | +Inquiry |
| PBK-263HKCL | Human PBK Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PBK Products
Required fields are marked with *
My Review for All PBK Products
Required fields are marked with *
