Recombinant Human PCDH19 protein, GST-tagged
Cat.No. : | PCDH19-15H |
Product Overview : | Recombinant Human PCDH19(241 a.a. - 340 a.a.) fused with GST tag at N-terminal was expressed in Wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 241-340 a.a. |
Description : | The protein encoded by this gene is a member of the delta-2 protocadherin subclass of the cadherin superfamily. The encoded protein is thought to be a calcium-dependent cell-adhesion protein that is primarily expressed in the brain. Defects in this gene are a cause of epilepsy female-restricted with mental retardation (EFMR). Three transcript variants encoding different isoforms have been found for this gene |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | RLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQP DLIINGAPLPETENYSFDSNYVNSR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | PCDH19 protocadherin 19 [ Homo sapiens ] |
Official Symbol | PCDH19 |
Synonyms | PCDH19; protocadherin 19; EFMR, epilepsy, female restricted, with mental retardation (Juberg Hellman syndrome); protocadherin-19; EIEE9; KIAA1313; EFMR; DKFZp686P1843; |
Gene ID | 57526 |
mRNA Refseq | NM_001105243 |
Protein Refseq | NP_001098713 |
MIM | 300460 |
UniProt ID | Q8TAB3 |
Chromosome Location | Xq22.1 |
Function | calcium ion binding; |
◆ Recombinant Proteins | ||
PCDH19-6538M | Recombinant Mouse PCDH19 Protein, His (Fc)-Avi-tagged | +Inquiry |
PCDH19-6801Z | Recombinant Zebrafish PCDH19 | +Inquiry |
PCDH19-3138R | Recombinant Rhesus Macaque PCDH19 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pcdh19-1906R | Recombinant Rat Pcdh19 Protein, His-tagged | +Inquiry |
PCDH19-15H | Recombinant Human PCDH19 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCDH19 Products
Required fields are marked with *
My Review for All PCDH19 Products
Required fields are marked with *