Recombinant Human PCDH7

• Cat.No.: PCDH7-29959TH
• Product Overview: Recombinant fragment: KQLLRYRLAE EGPADVRIGN VASDLGIVTG SGEVTFSLES GSEYLKIDNL TGELSTSERR IDREKLPQCQ MIFDENECFL DFEVSVIGPS QSWV of Human PCDH7 (amino acids 31-124) with N terminal proprietary tag, 35.97 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 94 amino acids
• Description: This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes a protein with an extracellular domain containing 7 cadherin repeats. The gene product is an integral membrane protein that is thought to function in cell-cell recognition and adhesion. Alternative splicing yields isoforms with unique cytoplasmic tails.
• Molecular Weight: 35.970kDa inclusive of tags
• Tissue specificity: Expressed predominantly in brain and heart and at lower levels in various other tissues.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KQLLRYRLAEEGPADVRIGNVASDLGIVTGSGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWV
• Sequence Similarities: Contains 7 cadherin domains.

Gene Information

• Gene Name: PCDH7 protocadherin 7 [ Homo sapiens ]
• Official Symbol: PCDH7
• Synonyms: PCDH7; protocadherin 7; BH protocadherin (brain heart); protocadherin-7; BH Pcdh
• Gene ID: 5099
• mRNA Refseq: NM_001173523
• Protein Refseq: NP_001166994
• MIM: 602988
• Uniprot ID: O60245
• Chromosome Location: 4p15
• Function: calcium ion binding