Recombinant Human PCDHB11
Cat.No. : | PCDHB11-1562H |
Product Overview : | Recombinant Human PCDHB11 was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific cell-cell neural connections. |
Form : | Liquid |
Molecular Mass : | 87.7 kDa |
AA Sequence : | MENQGTRTQQIRQVLLLFVLLGMSQAGSETWSFSVAEEMQSGSFVGNLAKDLGLKVRELSSRGARVVSNDKKQRL QLDINTGDLLLSETLDREELCGSIEPCVLHLQVLMQNPTQFLQIELQVRDINDHSPIFSEKQMLLEIPENSPVGA VFLLESAKDLDVGINAVKSYTISPNSHFHIKMRVIPDNRKYPELVLDKALDYEELPELSFILSALDGGSPPRSGT ALVRVVVVDINDNSPEFEQAFYEVKIRENSILGSLILIVSAWDLDSGTNGEICYTFSHASEDIRKTFEINQKSGE ITLRAPLDFETIESYSIIIQATDGGGLFGKSTVIIHVIDVNDNAPEITVSSITSPIPENTPETVVMVFSIQDIDS GDNGRIVCSIPEDLPFVLKSSVENYYTLETERPLDRESTAEYNITITVTDLGIPRLKTEHNTTVLVSDVNDNAPT FTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVNYSLLPPQDLHLPLASLVSINTDNGHLFALRSLDYEALQ AFDFRVGATDRGSPALSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNA WLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLQVLLVDGFSQPYLPLPE AAPAQAQADSLTVYLVVALASVSSLFLFSVLLFVAVRLCRRSRAASVGSCSVPKGPFPGHLVDVSGTGTLSQSYQ YEVCLTGGSETNEFKFLKPVIPNIQAKGLGKNSEENSTFRNSFGFNF |
Applications : | Antibody Production; Functional Study; Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | PCDHB11 protocadherin beta 11 [ Homo sapiens ] |
Official Symbol | PCDHB11 |
Synonyms | PCDHB11; protocadherin beta 11; protocadherin beta-11; cadherin ME2; ME2; PCDH BETA11; PCDH-beta-11; PCDH-BETA11; MGC138337; MGC142171 |
Gene ID | 56125 |
mRNA Refseq | NM_018931 |
Protein Refseq | NP_061754 |
MIM | 606337 |
UniProt ID | Q9Y5F2 |
Chromosome Location | 5q31 |
Function | calcium ion binding |
◆ Recombinant Proteins | ||
PCDHB11-1562H | Recombinant Human PCDHB11 | +Inquiry |
PCDHB11-1561H | Recombinant Human PCDHB11, His-tagged | +Inquiry |
PCDHB11-7025HF | Recombinant Full Length Human PCDHB11 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCDHB11 Products
Required fields are marked with *
My Review for All PCDHB11 Products
Required fields are marked with *
0
Inquiry Basket