Recombinant Human PCGF5 protein, His-tagged

• Cat.No.: PCGF5-8888H
• Product Overview: Recombinant Human PCGF5 protein(1-50 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-50 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTSAESYWMSTWMS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: PCGF5 polycomb group ring finger 5 [ Homo sapiens ]
• Official Symbol: PCGF5
• Synonyms: PCGF5; polycomb group ring finger 5; ring finger protein (C3HC4 type) 159 , RNF159; polycomb group RING finger protein 5; MGC16202; RING finger protein 159; ring finger protein (C3HC4 type) 159; RNF159
• Gene ID: 84333
• mRNA Refseq: NM_001256549
• Protein Refseq: NP_001243478
• UniProt ID: Q86SE9