Recombinant Human PCMT1
| Cat.No. : | PCMT1-30554TH |
| Product Overview : | Recombinant full length Human PCMT1 expressed in Saccharomyces cerevisiae; 227 amino acids, MWt 24.6 kDa. Protein is tagged with 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Non |
| Description : | This gene encodes a member of the type II class of protein carboxyl methyltransferase enzymes. The encoded enzyme plays a role in protein repair by recognizing and converting D-aspartyl and L-isoaspartyl residues resulting from spontaneous deamidation back to the normal L-aspartyl form. The encoded protein may play a protective role in the pathogenesis of Alzheimers disease, and single nucleotide polymorphisms in this gene have been associated with spina bifida and premature ovarian failure. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHY AKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHE GAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELV DDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAI HVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQ YDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRWK |
| Full Length : | Full L. |
| Gene Name | PCMT1 protein-L-isoaspartate (D-aspartate) O-methyltransferase [ Homo sapiens ] |
| Official Symbol | PCMT1 |
| Synonyms | PCMT1; protein-L-isoaspartate (D-aspartate) O-methyltransferase; protein-L-isoaspartate(D-aspartate) O-methyltransferase; |
| Gene ID | 5110 |
| mRNA Refseq | NM_001252049 |
| Protein Refseq | NP_001238978 |
| MIM | 176851 |
| Uniprot ID | P22061 |
| Chromosome Location | 6q22.3-q24 |
| Function | protein-L-isoaspartate (D-aspartate) O-methyltransferase activity; transferase activity; |
| ◆ Recombinant Proteins | ||
| PCMT1-30554TH | Recombinant Human PCMT1 | +Inquiry |
| PCMT1-5305P | Recombinant Pig PCMT1 protein, Avi-tagged, Biotinylated | +Inquiry |
| PCMT1-1978HFL | Recombinant Full Length Human PCMT1 Protein, C-Flag-tagged | +Inquiry |
| PCMT1-1619H | Recombinant Human PCMT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PCMT1-704H | Recombinant Human PCMT1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PCMT1-3377HCL | Recombinant Human PCMT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCMT1 Products
Required fields are marked with *
My Review for All PCMT1 Products
Required fields are marked with *
