Recombinant Human PCNP, His-tagged
| Cat.No. : | PCNP-29259TH |
| Product Overview : | Recombinant full length Human PCNP with an N terminal His tag; 202 amino acids including tag, Predicted MWt 25.1 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 178 amino acids |
| Description : | May be involved in cell cycle regulation. |
| Conjugation : | HIS |
| Molecular Weight : | 21.500kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKISKFGFAIGSQTTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQDN |
| Gene Name | PCNP PEST proteolytic signal containing nuclear protein [ Homo sapiens ] |
| Official Symbol | PCNP |
| Synonyms | PCNP; PEST proteolytic signal containing nuclear protein; PEST proteolytic signal-containing nuclear protein; |
| Gene ID | 57092 |
| mRNA Refseq | NM_020357 |
| Protein Refseq | NP_065090 |
| Uniprot ID | Q8WW12 |
| Chromosome Location | 3q12.3 |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| Pcnp-4716M | Recombinant Mouse Pcnp Protein, Myc/DDK-tagged | +Inquiry |
| PCNP-29258TH | Recombinant Human PCNP | +Inquiry |
| PCNP-3965R | Recombinant Rat PCNP Protein, His (Fc)-Avi-tagged | +Inquiry |
| PCNP-1550Z | Recombinant Zebrafish PCNP | +Inquiry |
| PCNP-4303R | Recombinant Rat PCNP Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PCNP-3376HCL | Recombinant Human PCNP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCNP Products
Required fields are marked with *
My Review for All PCNP Products
Required fields are marked with *
