Recombinant Human PCNP, His-tagged
Cat.No. : | PCNP-29259TH |
Product Overview : | Recombinant full length Human PCNP with an N terminal His tag; 202 amino acids including tag, Predicted MWt 25.1 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 178 amino acids |
Description : | May be involved in cell cycle regulation. |
Conjugation : | HIS |
Molecular Weight : | 21.500kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKISKFGFAIGSQTTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQDN |
Gene Name | PCNP PEST proteolytic signal containing nuclear protein [ Homo sapiens ] |
Official Symbol | PCNP |
Synonyms | PCNP; PEST proteolytic signal containing nuclear protein; PEST proteolytic signal-containing nuclear protein; |
Gene ID | 57092 |
mRNA Refseq | NM_020357 |
Protein Refseq | NP_065090 |
Uniprot ID | Q8WW12 |
Chromosome Location | 3q12.3 |
Function | protein binding; |
◆ Recombinant Proteins | ||
Pcnp-4716M | Recombinant Mouse Pcnp Protein, Myc/DDK-tagged | +Inquiry |
PCNP-1400C | Recombinant Chicken PCNP | +Inquiry |
PCNP-5092H | Recombinant Human PEST Proteolytic Signal Containing Nuclear Protein, His-tagged | +Inquiry |
PCNP-4442H | Recombinant Human PCNP protein, GST-tagged | +Inquiry |
PCNP-29258TH | Recombinant Human PCNP | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCNP-3376HCL | Recombinant Human PCNP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCNP Products
Required fields are marked with *
My Review for All PCNP Products
Required fields are marked with *
0
Inquiry Basket