Recombinant Human PCNP, His-tagged

• Cat.No.: PCNP-29259TH
• Product Overview: Recombinant full length Human PCNP with an N terminal His tag; 202 amino acids including tag, Predicted MWt 25.1 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 178 amino acids
• Description: May be involved in cell cycle regulation.
• Conjugation: HIS
• Molecular Weight: 21.500kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKISKFGFAIGSQTTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQDN

Gene Information

• Gene Name: PCNP PEST proteolytic signal containing nuclear protein [ Homo sapiens ]
• Official Symbol: PCNP
• Synonyms: PCNP; PEST proteolytic signal containing nuclear protein; PEST proteolytic signal-containing nuclear protein
• Gene ID: 57092
• mRNA Refseq: NM_020357
• Protein Refseq: NP_065090
• Uniprot ID: Q8WW12
• Chromosome Location: 3q12.3
• Function: protein binding