Recombinant Human PCTP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PCTP-5204H |
Product Overview : | PCTP MS Standard C13 and N15-labeled recombinant protein (NP_067036) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | PCTP (Phosphatidylcholine Transfer Protein) is a Protein Coding gene. Diseases associated with PCTP include Leukoencephalopathy With Vanishing White Matter. Among its related pathways are Synthesis of PC and Metabolism. Gene Ontology (GO) annotations related to this gene include lipid binding and phosphatidylcholine transporter activity. An important paralog of this gene is STARD7. |
Molecular Mass : | 24.8 kDa |
AA Sequence : | MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PCTP phosphatidylcholine transfer protein [ Homo sapiens (human) ] |
Official Symbol | PCTP |
Synonyms | PCTP; phosphatidylcholine transfer protein; |
Gene ID | 58488 |
mRNA Refseq | NM_021213 |
Protein Refseq | NP_067036 |
MIM | 606055 |
UniProt ID | Q9UKL6 |
◆ Recombinant Proteins | ||
PCTP-1251H | Recombinant Human PCTP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PCTP-5204H | Recombinant Human PCTP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PCTP-1585H | Recombinant Human PCTP, GST-tagged | +Inquiry |
Pctp-4722M | Recombinant Mouse Pctp Protein, Myc/DDK-tagged | +Inquiry |
PCTP-4312R | Recombinant Rat PCTP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCTP-3368HCL | Recombinant Human PCTP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCTP Products
Required fields are marked with *
My Review for All PCTP Products
Required fields are marked with *