Recombinant Human PCTP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PCTP-5204H
Product Overview : PCTP MS Standard C13 and N15-labeled recombinant protein (NP_067036) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : PCTP (Phosphatidylcholine Transfer Protein) is a Protein Coding gene. Diseases associated with PCTP include Leukoencephalopathy With Vanishing White Matter. Among its related pathways are Synthesis of PC and Metabolism. Gene Ontology (GO) annotations related to this gene include lipid binding and phosphatidylcholine transporter activity. An important paralog of this gene is STARD7.
Molecular Mass : 24.8 kDa
AA Sequence : MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PCTP phosphatidylcholine transfer protein [ Homo sapiens (human) ]
Official Symbol PCTP
Synonyms PCTP; phosphatidylcholine transfer protein;
Gene ID 58488
mRNA Refseq NM_021213
Protein Refseq NP_067036
MIM 606055
UniProt ID Q9UKL6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCTP Products

Required fields are marked with *

My Review for All PCTP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon