Recombinant Human PDCD1LG2 protein, His-tagged
| Cat.No. : | PDCD1LG2-3324H |
| Product Overview : | Recombinant Human PDCD1LG2 protein(Q9BQ51)(21-118aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 21-118aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 15.1 kDa |
| AA Sequence : | FTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLK |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PDCD1LG2 programmed cell death 1 ligand 2 [ Homo sapiens ] |
| Official Symbol | PDCD1LG2 |
| Synonyms | PDCD1LG2; programmed cell death 1 ligand 2; B7 dendritic cell molecule; B7 DC; bA574F11.2; Btdc; CD273; PD L2; PDL2; B7-DC; PD-1 ligand 2; PD-1-ligand 2; PDCD1 ligand 2; butyrophilin B7-DC; programmed death ligand 2; B7DC; PD-L2; PDCD1L2; MGC142238; MGC142240; |
| Gene ID | 80380 |
| mRNA Refseq | NM_025239 |
| Protein Refseq | NP_079515 |
| MIM | 605723 |
| UniProt ID | Q9BQ51 |
| ◆ Recombinant Proteins | ||
| PDCD1LG2-2174H | Active Recombinant Human PDCD1LG2 protein, His-tagged | +Inquiry |
| PDCD1LG2-0642M | Active Recombinant Mouse PDCD1LG2 protein, Fc-tagged | +Inquiry |
| PDCD1LG2-269H | Recombinant Human PDCD1LG2 Protein (ECD), His-tagged(C-ter) | +Inquiry |
| PDCD1LG2-1218C | Active Recombinant Cynomolgus PDCD1LG2 protein, His-tagged | +Inquiry |
| Pdcd1lg2-542RAF488 | Recombinant Rat Pdcd1lg2 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDCD1LG2-951CCL | Recombinant Cynomolgus PDCD1LG2 cell lysate | +Inquiry |
| PDCD1LG2-1738MCL | Recombinant Mouse PDCD1LG2 cell lysate | +Inquiry |
| PDCD1LG2-2721HCL | Recombinant Human PDCD1LG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDCD1LG2 Products
Required fields are marked with *
My Review for All PDCD1LG2 Products
Required fields are marked with *
