"PDCD5" Related Products

Expand
Expand

Recombinant Human PDCD5 Protein

Cat.No. : PDCD5-001H
Product Overview : Recombinant Human PDCD5 (1-125aa) without tag was expressed in E.coli and purified by using conventional chromatography techniques.
Description : PDCD5, also known as programmed cell death5, which encodes a protein expressed in tumor cells during apoptosis independent of the apoptosis-inducing stimuli. Prior to apoptosis induction, this gene product is distributed in both the nucleus and cytoplasm. The conformation of PDCD5 protein is a stable helical core consisting of a triple-helix bundle and two dissociated terminal regions. This is an important novel protein that regulates both apoptotic and non-apoptotic programmed cell death.
Source : E.coli
Species : Human
Form : Liquid
Molecular Mass : 14.2 kDa
AASequence : MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
Purity : > 90% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1.0 mg/mL (determined by Bradford assay)
Storage Buffer : In Phosphate Buffered Saline (pH 7.4)
Warning : For research use only. This product is not intended or approved for human, diagnostics or veterin
SDS-PAGE :

15% SDS-PAGE (3 μg)

Gene Name : PDCD5 programmed cell death 5 [ Homo sapiens (human) ]
Official Symbol : PDCD5
Synonyms : PDCD5; programmed cell death 5; TFAR19; programmed cell death protein 5; TF-1 cell apoptosis-related protein 19; TF1 cell apoptosis-related gene 19; TFAR19 novel apoptosis-related
Gene ID : 9141
mRNA Refseq : NM_004708
Protein Refseq : NP_004699
MIM : 604583
UniProt ID : O14737

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.