Recombinant Human PDCD5 Protein

Cat.No. : PDCD5-001H
Product Overview : Recombinant Human PDCD5 (1-125aa) without tag was expressed in E.coli and purified by using conventional chromatography techniques.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 1-125 a.a.
Description : PDCD5, also known as programmed cell death5, which encodes a protein expressed in tumor cells during apoptosis independent of the apoptosis-inducing stimuli. Prior to apoptosis induction, this gene product is distributed in both the nucleus and cytoplasm. The conformation of PDCD5 protein is a stable helical core consisting of a triple-helix bundle and two dissociated terminal regions. This is an important novel protein that regulates both apoptotic and non-apoptotic programmed cell death.
Form : Liquid
Molecular Mass : 14.2 kDa
Purity : > 90% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1.0 mg/mL (determined by Bradford assay)
Storage Buffer : In Phosphate Buffered Saline (pH 7.4)
Warning : For research use only. This product is not intended or approved for human, diagnostics or veterin
AA Sequence : MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
Gene Name PDCD5 programmed cell death 5 [ Homo sapiens (human) ]
Official Symbol PDCD5
Synonyms PDCD5; programmed cell death 5; TFAR19; programmed cell death protein 5; TF-1 cell apoptosis-related protein 19; TF1 cell apoptosis-related gene 19; TFAR19 novel apoptosis-related
Gene ID 9141
mRNA Refseq NM_004708
Protein Refseq NP_004699
MIM 604583
UniProt ID O14737

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PDCD5 Products

Required fields are marked with *

My Review for All PDCD5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon