Recombinant Human PDCD5 Protein
| Cat.No. : | PDCD5-001H |
| Product Overview : | Recombinant Human PDCD5 (1-125aa) without tag was expressed in E.coli and purified by using conventional chromatography techniques. |
| Availability | November 28, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 1-125 a.a. |
| Description : | PDCD5, also known as programmed cell death5, which encodes a protein expressed in tumor cells during apoptosis independent of the apoptosis-inducing stimuli. Prior to apoptosis induction, this gene product is distributed in both the nucleus and cytoplasm. The conformation of PDCD5 protein is a stable helical core consisting of a triple-helix bundle and two dissociated terminal regions. This is an important novel protein that regulates both apoptotic and non-apoptotic programmed cell death. |
| Form : | Liquid |
| Molecular Mass : | 14.2 kDa |
| Purity : | > 90% by SDS - PAGE |
| Storage : | Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 1.0 mg/mL (determined by Bradford assay) |
| Storage Buffer : | In Phosphate Buffered Saline (pH 7.4) |
| Warning : | For research use only. This product is not intended or approved for human, diagnostics or veterin |
| AA Sequence : | MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY |
| Gene Name | PDCD5 programmed cell death 5 [ Homo sapiens (human) ] |
| Official Symbol | PDCD5 |
| Synonyms | PDCD5; programmed cell death 5; TFAR19; programmed cell death protein 5; TF-1 cell apoptosis-related protein 19; TF1 cell apoptosis-related gene 19; TFAR19 novel apoptosis-related |
| Gene ID | 9141 |
| mRNA Refseq | NM_004708 |
| Protein Refseq | NP_004699 |
| MIM | 604583 |
| UniProt ID | O14737 |
| ◆ Recombinant Proteins | ||
| PDCD5-378H | Recombinant Human Programmed Cell Death 5 | +Inquiry |
| PDCD5-3342R | Recombinant Rhesus monkey PDCD5 Protein, His-tagged | +Inquiry |
| PDCD5-4969C | Recombinant Chicken PDCD5 | +Inquiry |
| PDCD5-001H | Recombinant Human PDCD5 Protein | +Inquiry |
| PDCD5-1594H | Recombinant Human PDCD5 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDCD5-3360HCL | Recombinant Human PDCD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDCD5 Products
Required fields are marked with *
My Review for All PDCD5 Products
Required fields are marked with *
