Recombinant Human PDCD6IP protein(402-652aa), His-tagged
| Cat.No. : | PDCD6IP-2793H |
| Product Overview : | Recombinant Human PDCD6IP protein(Q8WUM4)(402-652aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 402-652aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 32.3 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | PAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEV |
| Gene Name | PDCD6IP programmed cell death 6 interacting protein [ Homo sapiens ] |
| Official Symbol | PDCD6IP |
| Synonyms | PDCD6IP; programmed cell death 6 interacting protein; programmed cell death 6-interacting protein; AIP1; ALG 2 interacting protein X; Alix; Hp95; PDCD6-interacting protein; ALG-2 interacting protein 1; dopamine receptor interacting protein 4; apoptosis-linked gene 2-interacting protein X; ALIX; HP95; DRIP4; MGC17003; |
| Gene ID | 10015 |
| mRNA Refseq | NM_001162429 |
| Protein Refseq | NP_001155901 |
| MIM | 608074 |
| UniProt ID | Q8WUM4 |
| ◆ Recombinant Proteins | ||
| PDCD6IP-151H | Recombinant Human PDCD6IP Protein, His-tagged | +Inquiry |
| PDCD6IP-1938H | Recombinant Human PDCD6IP, His-tagged | +Inquiry |
| Pdcd6ip-4736M | Recombinant Mouse Pdcd6ip Protein, Myc/DDK-tagged | +Inquiry |
| Pdcd6ip-6716M | Recombinant Mouse Pdcd6ip protein, His & T7-tagged | +Inquiry |
| PDCD6IP-12540Z | Recombinant Zebrafish PDCD6IP | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDCD6IP-3358HCL | Recombinant Human PDCD6IP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDCD6IP Products
Required fields are marked with *
My Review for All PDCD6IP Products
Required fields are marked with *
