Recombinant Human PDE1C protein, His-tagged
Cat.No. : | PDE1C-7843H |
Product Overview : | Recombinant Human PDE1C protein(284-634 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 284-634 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | RSDPAILYNDRSVLENHHLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKARMAAEEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGEQQQNGDFKDGKNKTDKKDHSNIGNDSKKTDDSQE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PDE1C phosphodiesterase 1C, calmodulin-dependent 70kDa [ Homo sapiens ] |
Official Symbol | PDE1C |
Synonyms | PDE1C; phosphodiesterase 1C, calmodulin-dependent 70kDa; phosphodiesterase 1C, calmodulin dependent (70kD); calcium/calmodulin-dependent 3,5-cyclic nucleotide phosphodiesterase 1C; Hcam3; hCam-3; cam-PDE 1C; Human 3,5 cyclic nucleotide phosphodiesterase (HSPDE1C1A); |
Gene ID | 5137 |
mRNA Refseq | NM_001191056 |
Protein Refseq | NP_001177985 |
MIM | 602987 |
UniProt ID | Q14123 |
◆ Recombinant Proteins | ||
PDE1C-7844H | Recombinant Human PDE1C protein, GST-tagged | +Inquiry |
Pde1c-443M | Recombinant Mouse Phosphodiesterase 1C, GST-tagged | +Inquiry |
PDE1C-047H | Recombinant Human PDE1C Protein, His/GST-tagged | +Inquiry |
PDE1C-7362H | Recombinant Human PDE1C protein(Met1-Glu634), His&GST-tagged | +Inquiry |
PDE1C-7843H | Recombinant Human PDE1C protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE1C-001HCL | Recombinant Human PDE1C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDE1C Products
Required fields are marked with *
My Review for All PDE1C Products
Required fields are marked with *