Recombinant Human PDF, GST-tagged

Cat.No. : PDF-7830H
Product Overview : Recombinant Human PDF(1 a.a. - 108 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Protein synthesis proceeds after formylation of methionine by methionyl-tRNA formyl transferase (FMT) and transfer of the charged initiator f-met tRNA to the ribosome. In eubacteria and eukaryotic organelles the product of this gene, peptide deformylase (PDF), removes the formyl group from the initiating methionine of nascent peptides. In eubacteria, deformylation of nascent peptides is required for subsequent cleavage of initiating methionines by methionine aminopeptidase. The discovery that a natural inhibitor of PDF, actinonin, acts as an antimicrobial agent in some bacteria has spurred intensive research into the design of bacterial-specific PDF inhibitors. In human cells, only mitochondrial proteins have N-formylation of initiating methionines. Protein inhibitors of PDF or siRNAs of PDF block the growth of cancer cell lines but have no effect on normal cell growth. In humans, PDF function may therefore be restricted to rapidly growing cells.
Molecular Mass : 39.1 kDa
AA Sequence : MTRRWGPSSQLQHQSLPPRSHAWSPRAQPARREGERRRRPNRPAWGPSRRPLPPERGLDPNGEQVVWQASGWAAR IIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PDF peptide deformylase (mitochondrial) [ Homo sapiens (human) ]
Official Symbol PDF
Synonyms PDF; peptide deformylase (mitochondrial); peptide deformylase, mitochondrial; polypeptide deformylase; peptide deformylase-like protein; NP_071736.1; EC 3.5.1.88
Gene ID 64146
mRNA Refseq NM_022341
Protein Refseq NP_071736
UniProt ID Q9HBH1
Chromosome Location 16q22.1
Function iron ion binding; peptide deformylase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDF Products

Required fields are marked with *

My Review for All PDF Products

Required fields are marked with *

0
cart-icon