Recombinant Human PDIA4, His-tagged

• Cat.No.: PDIA4-125H
• Product Overview: Recombinant Human Protein Disulfide-Isomerase A4/PDIA4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val21-Leu645) of Human PDIA4 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 21-645 a.a.
• Description: Protein Disulfide-Isomerase A4 (PDIA4) is an endoplasmic reticulum luminal protein that belongs to the protein disulfide isomerase family. Human PDIA4 is synthesized as a 625 amino acid precursor that contains a 20 amino acid signal sequence, and a 625 amino acid mature chain, including three thioredoxin domains. PDIA4 catalyzes the rearrangement of -S-S- bonds in proteins and is thought to be a deoxycytidine kinase. In addition, PDIA4 serves as a proteases protein disulfide isomerase, phospholipase or an arrangement of these.
• AA Sequence: VAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLLE FYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVD YEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPE YEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREK
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Information

• Gene Name: PDIA4 protein disulfide isomerase family A, member 4 [ Homo sapiens(human) ]
• Official Symbol: PDIA4
• Synonyms: PDIA4; ERP70; ERP72; ERp-72; protein disulfide isomerase family A, member 4; protein disulfide-isomerase A4; ER protein 70; ER protein 72; protein disulfide isomerase-associated 4; endoplasmic reticulum resident protein 70; endoplasmic reticulum resident protein 72; protein disulfide isomerase related protein (calcium-binding protein, intestinal-related); EC 5.3.4.1
• Gene ID: 9601
• mRNA Refseq: NM_004911
• Protein Refseq: NP_004902
• UniProt ID: P13667
• Chromosome Location: 7q35
• Pathway: Protein processing in endoplasmic reticulum; Thyroid hormone synthesis; Vibrio cholerae infection
• Function: electron carrier activity; protein binding; protein disulfide isomerase activity