Recombinant Human PDIA4, His-tagged

Cat.No. : PDIA4-125H
Product Overview : Recombinant Human Protein Disulfide-Isomerase A4/PDIA4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val21-Leu645) of Human PDIA4 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 21-645 a.a.
Description : Protein Disulfide-Isomerase A4 (PDIA4) is an endoplasmic reticulum luminal protein that belongs to the protein disulfide isomerase family. Human PDIA4 is synthesized as a 625 amino acid precursor that contains a 20 amino acid signal sequence, and a 625 amino acid mature chain, including three thioredoxin domains. PDIA4 catalyzes the rearrangement of -S-S- bonds in proteins and is thought to be a deoxycytidine kinase. In addition, PDIA4 serves as a proteases protein disulfide isomerase, phospholipase or an arrangement of these.
AA Sequence : VAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLLE FYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVD YEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPE YEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREK
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name PDIA4 protein disulfide isomerase family A, member 4 [ Homo sapiens(human) ]
Official Symbol PDIA4
Synonyms PDIA4; ERP70; ERP72; ERp-72; protein disulfide isomerase family A, member 4; protein disulfide-isomerase A4; ER protein 70; ER protein 72; protein disulfide isomerase-associated 4; endoplasmic reticulum resident protein 70; endoplasmic reticulum resident protein 72; protein disulfide isomerase related protein (calcium-binding protein, intestinal-related); EC 5.3.4.1
Gene ID 9601
mRNA Refseq NM_004911
Protein Refseq NP_004902
UniProt ID P13667
Chromosome Location 7q35
Pathway Protein processing in endoplasmic reticulum; Thyroid hormone synthesis; Vibrio cholerae infection
Function electron carrier activity; protein binding; protein disulfide isomerase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDIA4 Products

Required fields are marked with *

My Review for All PDIA4 Products

Required fields are marked with *

0
cart-icon