Recombinant Human PDIA4, His-tagged
Cat.No. : | PDIA4-125H |
Product Overview : | Recombinant Human Protein Disulfide-Isomerase A4/PDIA4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val21-Leu645) of Human PDIA4 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 21-645 a.a. |
Description : | Protein Disulfide-Isomerase A4 (PDIA4) is an endoplasmic reticulum luminal protein that belongs to the protein disulfide isomerase family. Human PDIA4 is synthesized as a 625 amino acid precursor that contains a 20 amino acid signal sequence, and a 625 amino acid mature chain, including three thioredoxin domains. PDIA4 catalyzes the rearrangement of -S-S- bonds in proteins and is thought to be a deoxycytidine kinase. In addition, PDIA4 serves as a proteases protein disulfide isomerase, phospholipase or an arrangement of these. |
AA Sequence : | VAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLLE FYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVD YEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPE YEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREK |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | PDIA4 protein disulfide isomerase family A, member 4 [ Homo sapiens(human) ] |
Official Symbol | PDIA4 |
Synonyms | PDIA4; ERP70; ERP72; ERp-72; protein disulfide isomerase family A, member 4; protein disulfide-isomerase A4; ER protein 70; ER protein 72; protein disulfide isomerase-associated 4; endoplasmic reticulum resident protein 70; endoplasmic reticulum resident protein 72; protein disulfide isomerase related protein (calcium-binding protein, intestinal-related); EC 5.3.4.1 |
Gene ID | 9601 |
mRNA Refseq | NM_004911 |
Protein Refseq | NP_004902 |
UniProt ID | P13667 |
Chromosome Location | 7q35 |
Pathway | Protein processing in endoplasmic reticulum; Thyroid hormone synthesis; Vibrio cholerae infection |
Function | electron carrier activity; protein binding; protein disulfide isomerase activity |
◆ Recombinant Proteins | ||
PDIA4-10168Z | Recombinant Zebrafish PDIA4 | +Inquiry |
PDIA4-1616H | Recombinant Human PDIA4, GST-tagged | +Inquiry |
PDIA4-122H | Recombinant Human PDIA4 protein, His-tagged | +Inquiry |
PDIA4-12578M | Recombinant Mouse PDIA4 Protein | +Inquiry |
PDIA4-4005R | Recombinant Rat PDIA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDIA4-1285HCL | Recombinant Human PDIA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDIA4 Products
Required fields are marked with *
My Review for All PDIA4 Products
Required fields are marked with *
0
Inquiry Basket