Recombinant Human PDIA5 protein, His-tagged
Cat.No. : | PDIA5-1617H |
Product Overview : | Recombinant Human PDIA5 protein(1-262 aa), fused with His tag, was expressed in E.coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-262 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MARAGPAWLLLAIWVVLPSWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKKVWPL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PDIA5 protein disulfide isomerase family A, member 5 [ Homo sapiens ] |
Official Symbol | PDIA5 |
Synonyms | PDIA5; protein disulfide isomerase family A, member 5; protein disulfide isomerase associated 5; protein disulfide-isomerase A5; FLJ30401; PDIR; protein disulfide isomerase-associated 5; protein disulfide isomerase-related protein; |
Gene ID | 10954 |
mRNA Refseq | NM_006810 |
Protein Refseq | NP_006801 |
UniProt ID | Q14554 |
◆ Recombinant Proteins | ||
PDIA5-4346R | Recombinant Rat PDIA5 Protein | +Inquiry |
PDIA5-12579M | Recombinant Mouse PDIA5 Protein | +Inquiry |
PDIA5-8230H | Recombinant Human PDIA5 protein, His & T7-tagged | +Inquiry |
PDIA5-3944H | Recombinant Human PDIA5 Protein (Ser22-Leu262), C-His tagged | +Inquiry |
PDIA5-6604M | Recombinant Mouse PDIA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDIA5-1323HCL | Recombinant Human PDIA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDIA5 Products
Required fields are marked with *
My Review for All PDIA5 Products
Required fields are marked with *