Recombinant Human PDIA5 protein, His-tagged
| Cat.No. : | PDIA5-1617H |
| Product Overview : | Recombinant Human PDIA5 protein(1-262 aa), fused with His tag, was expressed in E.coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-262 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MARAGPAWLLLAIWVVLPSWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKKVWPL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PDIA5 protein disulfide isomerase family A, member 5 [ Homo sapiens ] |
| Official Symbol | PDIA5 |
| Synonyms | PDIA5; protein disulfide isomerase family A, member 5; protein disulfide isomerase associated 5; protein disulfide-isomerase A5; FLJ30401; PDIR; protein disulfide isomerase-associated 5; protein disulfide isomerase-related protein; |
| Gene ID | 10954 |
| mRNA Refseq | NM_006810 |
| Protein Refseq | NP_006801 |
| UniProt ID | Q14554 |
| ◆ Recombinant Proteins | ||
| PDIA5-8230H | Recombinant Human PDIA5 protein, His & T7-tagged | +Inquiry |
| PDIA5-6604M | Recombinant Mouse PDIA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PDIA5-3944H | Recombinant Human PDIA5 Protein (Ser22-Leu262), C-His tagged | +Inquiry |
| PDIA5-4006R | Recombinant Rat PDIA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PDIA5-6318Z | Recombinant Zebrafish PDIA5 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDIA5-1323HCL | Recombinant Human PDIA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDIA5 Products
Required fields are marked with *
My Review for All PDIA5 Products
Required fields are marked with *
