Recombinant Human PDLIM2, His-tagged
Cat.No. : | PDLIM2-29566TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 188-352 of Human PDLIM2 with N terminal His tag; 165 amino acids, 22kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 188-352 a.a. |
Description : | This gene encodes a member of the ALP subfamily of PDZ-LIM domain proteins. The encoded protein suppresses anchorage-dependent growth and promotes cell migration and adhesion through interactions with the actin cytoskeleton via the PDZ domain. The encoded protein is also a putative tumor suppressor protein, and decreased expression of this gene is associated with several malignancies including breast cancer and adult T-cell leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 126 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DSAVLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQ ENREGRAAPRQSSSFRLLQEALEAEERGGTPAFLPSSL SPQSSLPASRALATPPKLHTCEKCSTSIANQAVRIQEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYS APATLSSRA |
Sequence Similarities : | Contains 1 LIM zinc-binding domain.Contains 1 PDZ (DHR) domain. |
Gene Name | PDLIM2 PDZ and LIM domain 2 (mystique) [ Homo sapiens ] |
Official Symbol | PDLIM2 |
Synonyms | PDLIM2; PDZ and LIM domain 2 (mystique); PDZ and LIM domain protein 2; |
Gene ID | 64236 |
mRNA Refseq | NM_021630 |
Protein Refseq | NP_067643 |
MIM | 609722 |
Uniprot ID | Q96JY6 |
Chromosome Location | 8p21.3 |
Function | metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
PDLIM2-29566TH | Recombinant Human PDLIM2, His-tagged | +Inquiry |
PDLIM2-4012R | Recombinant Rat PDLIM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PDLIM2-6610M | Recombinant Mouse PDLIM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pdlim2-4771M | Recombinant Mouse Pdlim2 Protein, Myc/DDK-tagged | +Inquiry |
PDLIM2-5379H | Recombinant Human PDLIM2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDLIM2-3326HCL | Recombinant Human PDLIM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDLIM2 Products
Required fields are marked with *
My Review for All PDLIM2 Products
Required fields are marked with *
0
Inquiry Basket