Recombinant Human PDLIM5 protein, His-tagged
| Cat.No. : | PDLIM5-3458H |
| Product Overview : | Recombinant Human PDLIM5 protein(351-596 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 351-596 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | PVGSTGVIKSPSWQRPNQGVPSTGRISNSAAYSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PDLIM5 PDZ and LIM domain 5 [ Homo sapiens ] |
| Official Symbol | PDLIM5 |
| Synonyms | PDLIM5; PDZ and LIM domain 5; PDZ and LIM domain protein 5; Enh; LIM; enigma homolog; enigma-like LIM domain protein; enigma-like PDZ and LIM domains protein; L9; ENH; ENH1; |
| Gene ID | 10611 |
| mRNA Refseq | NM_001011513 |
| Protein Refseq | NP_001011513 |
| MIM | 605904 |
| UniProt ID | Q96HC4 |
| ◆ Recombinant Proteins | ||
| PDLIM5-4644H | Recombinant Human PDLIM5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PDLIM5-2821C | Recombinant Chicken PDLIM5 | +Inquiry |
| PDLIM5-4014R | Recombinant Rat PDLIM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Pdlim5-4773M | Recombinant Mouse Pdlim5 Protein, Myc/DDK-tagged | +Inquiry |
| PDLIM5-1624H | Recombinant Human PDLIM5 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDLIM5-3325HCL | Recombinant Human PDLIM5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDLIM5 Products
Required fields are marked with *
My Review for All PDLIM5 Products
Required fields are marked with *
