Recombinant Human PDLIM5 protein, His-tagged
Cat.No. : | PDLIM5-3458H |
Product Overview : | Recombinant Human PDLIM5 protein(351-596 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 351-596 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | PVGSTGVIKSPSWQRPNQGVPSTGRISNSAAYSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PDLIM5 PDZ and LIM domain 5 [ Homo sapiens ] |
Official Symbol | PDLIM5 |
Synonyms | PDLIM5; PDZ and LIM domain 5; PDZ and LIM domain protein 5; Enh; LIM; enigma homolog; enigma-like LIM domain protein; enigma-like PDZ and LIM domains protein; L9; ENH; ENH1; |
Gene ID | 10611 |
mRNA Refseq | NM_001011513 |
Protein Refseq | NP_001011513 |
MIM | 605904 |
UniProt ID | Q96HC4 |
◆ Recombinant Proteins | ||
PDLIM5-1641H | Recombinant Human PDLIM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PDLIM5-1606HFL | Recombinant Full Length Human PDLIM5 Protein, C-Flag-tagged | +Inquiry |
PDLIM5-3458H | Recombinant Human PDLIM5 protein, His-tagged | +Inquiry |
PDLIM5-4644H | Recombinant Human PDLIM5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDLIM5-4354R | Recombinant Rat PDLIM5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDLIM5-3325HCL | Recombinant Human PDLIM5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDLIM5 Products
Required fields are marked with *
My Review for All PDLIM5 Products
Required fields are marked with *
0
Inquiry Basket