Recombinant Human PDXK, His-tagged
| Cat.No. : | PDXK-29673TH |
| Product Overview : | Recombinant full length Human PDXK.1 with N terminal His tag; 336 amino acids with tag, Predicted MWt 37.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 312 amino acids |
| Description : | The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
| Conjugation : | HIS |
| Molecular Weight : | 37.600kDa inclusive of tags |
| Tissue specificity : | Ubiquitous. Isoform 3 is detected in adult testis and spermatozoa. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL |
| Sequence Similarities : | Belongs to the pyridoxine kinase family. |
| Gene Name | PDXK pyridoxal (pyridoxine, vitamin B6) kinase [ Homo sapiens ] |
| Official Symbol | PDXK |
| Synonyms | PDXK; pyridoxal (pyridoxine, vitamin B6) kinase; C21orf97, C21orf124, chromosome 21 open reading frame 97 , chromosome 21 open reading frame 124; pyridoxal kinase; FLJ21324; FLJ31940; MGC15873; PKH; PNK; PRED79; |
| Gene ID | 8566 |
| mRNA Refseq | NM_003681 |
| Protein Refseq | NP_003672 |
| MIM | 179020 |
| Uniprot ID | O00764 |
| Chromosome Location | 21q22.3 |
| Pathway | Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Vitamin B6 metabolism, organism-specific biosystem; |
| Function | ATP binding; lithium ion binding; magnesium ion binding; nucleotide binding; potassium ion binding; |
| ◆ Recombinant Proteins | ||
| Pdxk-1845M | Recombinant Mouse Pdxk protein, His & T7-tagged | +Inquiry |
| Pdxk-4782M | Recombinant Mouse Pdxk Protein, Myc/DDK-tagged | +Inquiry |
| PDXK-2865H | Recombinant Human Pyridoxal (Pyridoxine, Vitamin B6) Kinase, His-tagged | +Inquiry |
| Pdxk-1846R | Recombinant Rat Pdxk protein, His & T7-tagged | +Inquiry |
| PDXK-5226H | Recombinant Human PDXK Protein (Gln29-Lys253), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDXK-3317HCL | Recombinant Human PDXK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDXK Products
Required fields are marked with *
My Review for All PDXK Products
Required fields are marked with *



