Recombinant Human PDXK, His-tagged
Cat.No. : | PDXK-29673TH |
Product Overview : | Recombinant full length Human PDXK.1 with N terminal His tag; 336 amino acids with tag, Predicted MWt 37.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 312 amino acids |
Description : | The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
Conjugation : | HIS |
Molecular Weight : | 37.600kDa inclusive of tags |
Tissue specificity : | Ubiquitous. Isoform 3 is detected in adult testis and spermatozoa. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL |
Sequence Similarities : | Belongs to the pyridoxine kinase family. |
Gene Name | PDXK pyridoxal (pyridoxine, vitamin B6) kinase [ Homo sapiens ] |
Official Symbol | PDXK |
Synonyms | PDXK; pyridoxal (pyridoxine, vitamin B6) kinase; C21orf97, C21orf124, chromosome 21 open reading frame 97 , chromosome 21 open reading frame 124; pyridoxal kinase; FLJ21324; FLJ31940; MGC15873; PKH; PNK; PRED79; |
Gene ID | 8566 |
mRNA Refseq | NM_003681 |
Protein Refseq | NP_003672 |
MIM | 179020 |
Uniprot ID | O00764 |
Chromosome Location | 21q22.3 |
Pathway | Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Vitamin B6 metabolism, organism-specific biosystem; |
Function | ATP binding; lithium ion binding; magnesium ion binding; nucleotide binding; potassium ion binding; |
◆ Recombinant Proteins | ||
PDXK-12603M | Recombinant Mouse PDXK Protein | +Inquiry |
Pdxk-1846R | Recombinant Rat Pdxk protein, His & T7-tagged | +Inquiry |
PDXK-3330H | Recombinant Human PDXK protein, GST-tagged | +Inquiry |
PDXK-4023R | Recombinant Rat PDXK Protein, His (Fc)-Avi-tagged | +Inquiry |
PDXK-5350C | Recombinant Chicken PDXK | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDXK-3317HCL | Recombinant Human PDXK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDXK Products
Required fields are marked with *
My Review for All PDXK Products
Required fields are marked with *
0
Inquiry Basket