Recombinant Human PDXK, His-tagged

Cat.No. : PDXK-29673TH
Product Overview : Recombinant full length Human PDXK.1 with N terminal His tag; 336 amino acids with tag, Predicted MWt 37.6 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 312 amino acids
Description : The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Conjugation : HIS
Molecular Weight : 37.600kDa inclusive of tags
Tissue specificity : Ubiquitous. Isoform 3 is detected in adult testis and spermatozoa.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSHMEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Sequence Similarities : Belongs to the pyridoxine kinase family.
Gene Name PDXK pyridoxal (pyridoxine, vitamin B6) kinase [ Homo sapiens ]
Official Symbol PDXK
Synonyms PDXK; pyridoxal (pyridoxine, vitamin B6) kinase; C21orf97, C21orf124, chromosome 21 open reading frame 97 , chromosome 21 open reading frame 124; pyridoxal kinase; FLJ21324; FLJ31940; MGC15873; PKH; PNK; PRED79;
Gene ID 8566
mRNA Refseq NM_003681
Protein Refseq NP_003672
MIM 179020
Uniprot ID O00764
Chromosome Location 21q22.3
Pathway Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Vitamin B6 metabolism, organism-specific biosystem;
Function ATP binding; lithium ion binding; magnesium ion binding; nucleotide binding; potassium ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDXK Products

Required fields are marked with *

My Review for All PDXK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon