Recombinant Human PDXK Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PDXK-4506H |
Product Overview : | PDXK MS Standard C13 and N15-labeled recombinant protein (NP_003672) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
Molecular Mass : | 35.1 kDa |
AA Sequence : | MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PDXK pyridoxal kinase [ Homo sapiens (human) ] |
Official Symbol | PDXK |
Synonyms | PDXK; pyridoxal (pyridoxine, vitamin B6) kinase; C21orf97, C21orf124, chromosome 21 open reading frame 97, chromosome 21 open reading frame 124; pyridoxal kinase; FLJ21324; FLJ31940; MGC15873; PKH; PNK; PRED79; pyridoxine kinase; vitamin B6 kinase; pyridoxamine kinase; C21orf97; C21orf124; FLJ37311; MGC31754; MGC52346; DKFZp566A071; |
Gene ID | 8566 |
mRNA Refseq | NM_003681 |
Protein Refseq | NP_003672 |
MIM | 179020 |
UniProt ID | O00764 |
◆ Recombinant Proteins | ||
Pdxk-4782M | Recombinant Mouse Pdxk Protein, Myc/DDK-tagged | +Inquiry |
PDXK-4363R | Recombinant Rat PDXK Protein | +Inquiry |
PDXK-5226H | Recombinant Human PDXK Protein (Gln29-Lys253), N-His tagged | +Inquiry |
PDXK-4023R | Recombinant Rat PDXK Protein, His (Fc)-Avi-tagged | +Inquiry |
PDXK-2865H | Recombinant Human Pyridoxal (Pyridoxine, Vitamin B6) Kinase, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDXK-3317HCL | Recombinant Human PDXK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDXK Products
Required fields are marked with *
My Review for All PDXK Products
Required fields are marked with *