Recombinant Human PDXK Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PDXK-4506H |
| Product Overview : | PDXK MS Standard C13 and N15-labeled recombinant protein (NP_003672) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
| Molecular Mass : | 35.1 kDa |
| AA Sequence : | MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PDXK pyridoxal kinase [ Homo sapiens (human) ] |
| Official Symbol | PDXK |
| Synonyms | PDXK; pyridoxal (pyridoxine, vitamin B6) kinase; C21orf97, C21orf124, chromosome 21 open reading frame 97, chromosome 21 open reading frame 124; pyridoxal kinase; FLJ21324; FLJ31940; MGC15873; PKH; PNK; PRED79; pyridoxine kinase; vitamin B6 kinase; pyridoxamine kinase; C21orf97; C21orf124; FLJ37311; MGC31754; MGC52346; DKFZp566A071; |
| Gene ID | 8566 |
| mRNA Refseq | NM_003681 |
| Protein Refseq | NP_003672 |
| MIM | 179020 |
| UniProt ID | O00764 |
| ◆ Recombinant Proteins | ||
| Pdxk-1846R | Recombinant Rat Pdxk protein, His & T7-tagged | +Inquiry |
| PDXK-2865H | Recombinant Human Pyridoxal (Pyridoxine, Vitamin B6) Kinase, His-tagged | +Inquiry |
| PDXK-5350C | Recombinant Chicken PDXK | +Inquiry |
| PDXK-5226H | Recombinant Human PDXK Protein (Gln29-Lys253), N-His tagged | +Inquiry |
| PDXK-12603M | Recombinant Mouse PDXK Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDXK-3317HCL | Recombinant Human PDXK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDXK Products
Required fields are marked with *
My Review for All PDXK Products
Required fields are marked with *



