Recombinant Human PDYN
Cat.No. : | PDYN-31089TH |
Product Overview : | Recombinant fragment of Human ProDynorphin with N terminal proprietary tag; Predicted MWt 31.13 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 50 amino acids |
Description : | The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Molecular Weight : | 31.130kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSGELFDA |
Sequence Similarities : | Belongs to the opioid neuropeptide precursor family. |
Gene Name | PDYN prodynorphin [ Homo sapiens ] |
Official Symbol | PDYN |
Synonyms | PDYN; prodynorphin; SCA23, spinocerebellar ataxia 23; proenkephalin-B; ADCA; beta neoendorphin; dynorphin; leu enkephalin; leumorphin; PENKB; preproenkephalin B; rimorphin; |
Gene ID | 5173 |
mRNA Refseq | NM_001190892 |
Protein Refseq | NP_001177821 |
MIM | 131340 |
Uniprot ID | P01213 |
Chromosome Location | 20p13 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G-protein activation, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; |
Function | opioid peptide activity; |
◆ Recombinant Proteins | ||
PDYN-241Z | Recombinant Zebrafish PDYN | +Inquiry |
PDYN-149H | Recombinant Human PDYN | +Inquiry |
PDYN-754P | Recombinant Pig PDYN protein, His-KSI-tagged | +Inquiry |
PDYN-3365R | Recombinant Rhesus monkey PDYN Protein, His-tagged | +Inquiry |
PDYN-3183R | Recombinant Rhesus Macaque PDYN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDYN-3316HCL | Recombinant Human PDYN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDYN Products
Required fields are marked with *
My Review for All PDYN Products
Required fields are marked with *