Recombinant Human PDYN

Cat.No. : PDYN-31089TH
Product Overview : Recombinant fragment of Human ProDynorphin with N terminal proprietary tag; Predicted MWt 31.13 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 50 amino acids
Description : The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Molecular Weight : 31.130kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSGELFDA
Sequence Similarities : Belongs to the opioid neuropeptide precursor family.
Gene Name PDYN prodynorphin [ Homo sapiens ]
Official Symbol PDYN
Synonyms PDYN; prodynorphin; SCA23, spinocerebellar ataxia 23; proenkephalin-B; ADCA; beta neoendorphin; dynorphin; leu enkephalin; leumorphin; PENKB; preproenkephalin B; rimorphin;
Gene ID 5173
mRNA Refseq NM_001190892
Protein Refseq NP_001177821
MIM 131340
Uniprot ID P01213
Chromosome Location 20p13
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G-protein activation, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem;
Function opioid peptide activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDYN Products

Required fields are marked with *

My Review for All PDYN Products

Required fields are marked with *

0
cart-icon