Recombinant Human PDZRN3 protein, His-tagged
| Cat.No. : | PDZRN3-4543H |
| Product Overview : | Recombinant Human PDZRN3 protein(770-871 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 770-871 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | TLEISPDNSLRRAAEGISCPSSEGAVGTTEAYGPASKNLLSITEDPEVGTPTYSPSLKELDPNQPLESKERRASDGSRSPTPSQKLGSAYLPSYHHSPYKHA |
| Gene Name | PDZRN3 PDZ domain containing ring finger 3 [ Homo sapiens ] |
| Official Symbol | PDZRN3 |
| Synonyms | PDZRN3; PDZ domain containing ring finger 3; E3 ubiquitin-protein ligase PDZRN3; KIAA1095; likely ortholog of mouse semaF cytoplasmic domain associated protein 3; LNX3; SEMACAP3; ligand of Numb protein X 3; PDZ domain-containing RING finger protein 3; semaphorin cytoplasmic domain-associated protein 3; |
| Gene ID | 23024 |
| mRNA Refseq | NM_015009 |
| Protein Refseq | NP_055824 |
| MIM | 609729 |
| UniProt ID | Q9UPQ7 |
| ◆ Recombinant Proteins | ||
| PDZRN3-4543H | Recombinant Human PDZRN3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDZRN3-1329HCL | Recombinant Human PDZRN3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDZRN3 Products
Required fields are marked with *
My Review for All PDZRN3 Products
Required fields are marked with *



