Recombinant Human PEBP1, His-tagged

• Cat.No.: PEBP1-30792TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-187 of Human PBP with N terminal His tag; Predicted MWt 22 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-187 a.a.
• Description: Phosphatidylethanolamine-binding protein 1 is a protein that in humans is encoded by the PEBP1 gene.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 106 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKV LTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKD PKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTG LHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASF RKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
• Sequence Similarities: Belongs to the phosphatidylethanolamine-binding protein family.
• Full Length: Full L.

Gene Information

• Gene Name: PEBP1 phosphatidylethanolamine binding protein 1 [ Homo sapiens ]
• Official Symbol: PEBP1
• Synonyms: PEBP1; phosphatidylethanolamine binding protein 1; PBP, prostatic binding protein; phosphatidylethanolamine-binding protein 1; HCNP; hippocampal cholinergic neurostimulating peptide; PEBP; Raf kinase inhibitory protein; RKIP
• Gene ID: 5037
• mRNA Refseq: NM_002567
• Protein Refseq: NP_002558
• MIM: 604591
• Uniprot ID: P30086
• Chromosome Location: 12q24
• Pathway: Aurora B signaling, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem
• Function: ATP binding; lipid binding; mitogen-activated protein kinase binding; nucleotide binding; peptidase inhibitor activity