Recombinant Human PEBP1, His-tagged
Cat.No. : | PEBP1-30792TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-187 of Human PBP with N terminal His tag; Predicted MWt 22 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-187 a.a. |
Description : | Phosphatidylethanolamine-binding protein 1 is a protein that in humans is encoded by the PEBP1 gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 106 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKV LTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKD PKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTG LHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASF RKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK |
Sequence Similarities : | Belongs to the phosphatidylethanolamine-binding protein family. |
Full Length : | Full L. |
Gene Name | PEBP1 phosphatidylethanolamine binding protein 1 [ Homo sapiens ] |
Official Symbol | PEBP1 |
Synonyms | PEBP1; phosphatidylethanolamine binding protein 1; PBP, prostatic binding protein; phosphatidylethanolamine-binding protein 1; HCNP; hippocampal cholinergic neurostimulating peptide; PEBP; Raf kinase inhibitory protein; RKIP; |
Gene ID | 5037 |
mRNA Refseq | NM_002567 |
Protein Refseq | NP_002558 |
MIM | 604591 |
Uniprot ID | P30086 |
Chromosome Location | 12q24 |
Pathway | Aurora B signaling, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function | ATP binding; lipid binding; mitogen-activated protein kinase binding; nucleotide binding; peptidase inhibitor activity; |
◆ Recombinant Proteins | ||
PEBP1-2042H | Recombinant Human PEBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PEBP1-4874H | Recombinant Human PEBP1 protein, His-tagged | +Inquiry |
PEBP1-4368R | Recombinant Rat PEBP1 Protein | +Inquiry |
PEBP1-6627M | Recombinant Mouse PEBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEBP1-601H | Recombinant Human PEBP1 Protein (Met1-Lys187) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEBP1-3311HCL | Recombinant Human PEBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PEBP1 Products
Required fields are marked with *
My Review for All PEBP1 Products
Required fields are marked with *