Recombinant Human PECAM1 Protein
| Cat.No. : | PECAM1-01H |
| Product Overview : | Recombinant human PECAM1 protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Description : | The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation. |
| Molecular Mass : | 13 kDa |
| AA Sequence : | LRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT |
| Purity : | > 90 % by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.0 mg/mL |
| Storage Buffer : | 50 mM Tris-Acetate, pH 7.5, 1 mM EDTA and 10% Glycerol |
| Gene Name | PECAM1 platelet and endothelial cell adhesion molecule 1 [ Homo sapiens (human) ] |
| Official Symbol | PECAM1 |
| Synonyms | PECAM1; platelet and endothelial cell adhesion molecule 1; CD31; PECA1; GPIIA'; PECAM-1; endoCAM; CD31/EndoCAM; platelet endothelial cell adhesion molecule; CD31 antigen; platelet endothelial cell adhesion molecule-1 |
| Gene ID | 5175 |
| mRNA Refseq | NM_000442 |
| Protein Refseq | NP_000433 |
| MIM | 173445 |
| UniProt ID | P16284 |
| ◆ Recombinant Proteins | ||
| Pecam1-1179R | Recombinant Rat Pecam1 Protein, His-tagged | +Inquiry |
| PECAM1-6375Z | Recombinant Zebrafish PECAM1 | +Inquiry |
| PECAM1-59H | Recombinant Human PECAM1, Fc-Tagged | +Inquiry |
| Pecam1-510R | Recombinant Rat Pecam1 Protein, His/GST-tagged | +Inquiry |
| PECAM1-2034H | Recombinant Human PECAM1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PECAM1-2266MCL | Recombinant Mouse PECAM1 cell lysate | +Inquiry |
| PECAM1-3049HCL | Recombinant Human PECAM1 cell lysate | +Inquiry |
| PECAM1-3050HCL | Recombinant Human PECAM1 cell lysate, Fc-tagged | +Inquiry |
| PECAM1-2798HCL | Recombinant Human PECAM1 cell lysate, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PECAM1 Products
Required fields are marked with *
My Review for All PECAM1 Products
Required fields are marked with *




