Recombinant Human PECAM1 Protein
Cat.No. : | PECAM1-01H |
Product Overview : | Recombinant human PECAM1 protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation. |
Molecular Mass : | 13 kDa |
AA Sequence : | LRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.0 mg/mL |
Storage Buffer : | 50 mM Tris-Acetate, pH 7.5, 1 mM EDTA and 10% Glycerol |
Gene Name | PECAM1 platelet and endothelial cell adhesion molecule 1 [ Homo sapiens (human) ] |
Official Symbol | PECAM1 |
Synonyms | PECAM1; platelet and endothelial cell adhesion molecule 1; CD31; PECA1; GPIIA'; PECAM-1; endoCAM; CD31/EndoCAM; platelet endothelial cell adhesion molecule; CD31 antigen; platelet endothelial cell adhesion molecule-1 |
Gene ID | 5175 |
mRNA Refseq | NM_000442 |
Protein Refseq | NP_000433 |
MIM | 173445 |
UniProt ID | P16284 |
◆ Recombinant Proteins | ||
PECAM1-6375Z | Recombinant Zebrafish PECAM1 | +Inquiry |
PECAM1-151H | Recombinant Human PECAM1 Protein, Fc-tagged | +Inquiry |
Pecam1-509M | Recombinant Mouse Pecam1 Protein, His-tagged | +Inquiry |
PECAM1-3122H | Recombinant Human PECAM1 protein, Fc-tagged | +Inquiry |
Pecam1-4788M | Recombinant Mouse Pecam1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PECAM1-3049HCL | Recombinant Human PECAM1 cell lysate | +Inquiry |
PECAM1-2798HCL | Recombinant Human PECAM1 cell lysate, His-tagged | +Inquiry |
PECAM1-2266MCL | Recombinant Mouse PECAM1 cell lysate | +Inquiry |
PECAM1-3050HCL | Recombinant Human PECAM1 cell lysate, Fc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PECAM1 Products
Required fields are marked with *
My Review for All PECAM1 Products
Required fields are marked with *
0
Inquiry Basket