Recombinant Human PECR Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PECR-6171H
Product Overview : PECR MS Standard C13 and N15-labeled recombinant protein (NP_060911) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Participates in chain elongation of fatty acids. Has no 2,4-dienoyl-CoA reductase activity.
Molecular Mass : 32.5 kDa
AA Sequence : MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEKAKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PECR peroxisomal trans-2-enoyl-CoA reductase [ Homo sapiens (human) ]
Official Symbol PECR
Synonyms PECR; peroxisomal trans-2-enoyl-CoA reductase; HSA250303; SDR29C1; short chain dehydrogenase/reductase family 29C; member 1; TERP; DCR-RP; pVI-ARL; 2,4-dienoyl-CoA reductase-related protein; putative short chain alcohol dehydrogenase; short chain dehydrogenase/reductase family 29C, member 1; DCRRP; PVIARL; HPDHASE;
Gene ID 55825
mRNA Refseq NM_018441
Protein Refseq NP_060911
MIM 605843
UniProt ID Q9BY49

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PECR Products

Required fields are marked with *

My Review for All PECR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon