Recombinant Human PECR Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PECR-6171H |
Product Overview : | PECR MS Standard C13 and N15-labeled recombinant protein (NP_060911) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Participates in chain elongation of fatty acids. Has no 2,4-dienoyl-CoA reductase activity. |
Molecular Mass : | 32.5 kDa |
AA Sequence : | MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEKAKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PECR peroxisomal trans-2-enoyl-CoA reductase [ Homo sapiens (human) ] |
Official Symbol | PECR |
Synonyms | PECR; peroxisomal trans-2-enoyl-CoA reductase; HSA250303; SDR29C1; short chain dehydrogenase/reductase family 29C; member 1; TERP; DCR-RP; pVI-ARL; 2,4-dienoyl-CoA reductase-related protein; putative short chain alcohol dehydrogenase; short chain dehydrogenase/reductase family 29C, member 1; DCRRP; PVIARL; HPDHASE; |
Gene ID | 55825 |
mRNA Refseq | NM_018441 |
Protein Refseq | NP_060911 |
MIM | 605843 |
UniProt ID | Q9BY49 |
◆ Recombinant Proteins | ||
PECR-2480Z | Recombinant Zebrafish PECR | +Inquiry |
PECR-56HFL | Recombinant Full Length Human PECR Protein, C-Flag-tagged | +Inquiry |
PECR-4030R | Recombinant Rat PECR Protein, His (Fc)-Avi-tagged | +Inquiry |
Pecr-495M | Recombinant Mouse Pecr Protein, MYC/DDK-tagged | +Inquiry |
PECR-6628M | Recombinant Mouse PECR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PECR-3309HCL | Recombinant Human PECR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PECR Products
Required fields are marked with *
My Review for All PECR Products
Required fields are marked with *