Recombinant Human PELI1 protein, His-tagged
Cat.No. : | PELI1-2335H |
Product Overview : | Recombinant Human PELI1 protein(Q96FA3)(1-418aa), fused to N-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 1-418aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.8 kDa |
AA Sequence : | MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PELI1 pellino E3 ubiquitin protein ligase 1 [ Homo sapiens ] |
Official Symbol | PELI1 |
Gene ID | 57162 |
mRNA Refseq | NM_020651.3 |
Protein Refseq | NP_065702.2 |
UniProt ID | Q96FA3 |
◆ Recombinant Proteins | ||
PELI1-3188R | Recombinant Rhesus Macaque PELI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PELI1-4742H | Recombinant Human PELI1 protein, His-tagged | +Inquiry |
PELI1-3370R | Recombinant Rhesus monkey PELI1 Protein, His-tagged | +Inquiry |
PELI1-5917H | Recombinant Human PELI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PELI1-4743H | Recombinant Human PELI1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PELI1-3304HCL | Recombinant Human PELI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PELI1 Products
Required fields are marked with *
My Review for All PELI1 Products
Required fields are marked with *
0
Inquiry Basket