Recombinant Human PELO Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PELO-5356H |
Product Overview : | PELO MS Standard C13 and N15-labeled recombinant protein (NP_057030) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein which contains a conserved nuclear localization signal. The encoded protein may have a role in spermatogenesis, cell cycle control, and in meiotic cell division. |
Molecular Mass : | 43.4 kDa |
AA Sequence : | MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PELO pelota mRNA surveillance and ribosome rescue factor [ Homo sapiens (human) ] |
Official Symbol | PELO |
Synonyms | PELO; pelota homolog (Drosophila); pelota (Drosophila) homolog; protein pelota homolog; CGI-17; PRO1770; |
Gene ID | 53918 |
mRNA Refseq | NM_015946 |
Protein Refseq | NP_057030 |
MIM | 605757 |
UniProt ID | Q9BRX2 |
◆ Recombinant Proteins | ||
PELO-6632M | Recombinant Mouse PELO Protein, His (Fc)-Avi-tagged | +Inquiry |
PELO-4372R | Recombinant Rat PELO Protein | +Inquiry |
PELO-3232C | Recombinant Chicken PELO | +Inquiry |
Pelo-275M | Recombinant Mouse Pelo Protein, MYC/DDK-tagged | +Inquiry |
PELO-12629M | Recombinant Mouse PELO Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PELO-3302HCL | Recombinant Human PELO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PELO Products
Required fields are marked with *
My Review for All PELO Products
Required fields are marked with *
0
Inquiry Basket