Recombinant Human PEO1 protein, GST-tagged
Cat.No. : | PEO1-301650H |
Product Overview : | Recombinant Human PEO1 (154-506 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu154-Lys506 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LVRPGDQQPRPLEALNGGFNLSRILRTALPAWHKSIVSFRQLREEVLGELSNVEQAAGLRWSRFPDLNRILKGHRKGELTVFTGPTGSGKTTFISEYALDLCSQGVNTLWGSFEISNVRLARVMLTQFAEGRLEDQLDKYDHWADRFEDLPLYFMTFHGQQSIRTVIDTMQHAVYVYDICHVIIDNLQFMMGHEQLSTDRIAAQDYIIGVFRKFATDNNCHVTLVIHPRKEDDDKELQTASIFGSAKASQEADNVLILQDRKLVTGPGKRYLQVSKNRFDGDVGVFPLEFNKNSLTFSIPPKNKARLKKIKDDTGPVAKKPSSGKKGATTQNSEICSGQAPTPDQPDTSKRSK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TWNK twinkle mtDNA helicase [ Homo sapiens (human) ] |
Official Symbol | TWNK |
Synonyms | PEO; PEO1; SCA8; ATXN8; IOSCA; PEOA3; SANDO; TWINL; MTDPS7; PRLTS5; C10orf2 |
Gene ID | 56652 |
mRNA Refseq | NM_001163812 |
Protein Refseq | NP_001157284 |
MIM | 606075 |
UniProt ID | Q96RR1 |
◆ Recombinant Proteins | ||
PEO1-2998C | Recombinant Chicken PEO1 | +Inquiry |
PEO1-5808H | Recombinant Human PEO1 protein, His-tagged | +Inquiry |
PEO1-301650H | Recombinant Human PEO1 protein, GST-tagged | +Inquiry |
PEO1-8300Z | Recombinant Zebrafish PEO1 | +Inquiry |
PEO1-12633M | Recombinant Mouse PEO1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PEO1 Products
Required fields are marked with *
My Review for All PEO1 Products
Required fields are marked with *