Recombinant Human peptidyl arginine deiminase 2 Protein, His-tagged

Cat.No. : PADI2-001H
Product Overview : Recombinant Human PADI2 Protein with C-His tag was expressed in E. coli.
Availability December 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-115 aa
Description : This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis. This gene exists in a cluster with four other paralogous genes.
Tag : C-His
Molecular Mass : 12.8 kDa
AA Sequence : MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAHHHHHHHH
Endotoxin : < 2 EU/μg by LAL
Purity : > 95% by SDS-PAGE.
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1 mg/mL
Storage Buffer : Sterile PBS, pH7.4
Gene Name PADI2 peptidyl arginine deiminase 2 [ Homo sapiens (human) ]
Official Symbol PADI2
Synonyms PADI2; peptidyl arginine deiminase 2; PAD2; PDI2; PAD-H19; protein-arginine deiminase type-2; peptidyl arginine deiminase, type II; protein-arginine deiminase type II; EC 3.5.3.15
Gene ID 11240
mRNA Refseq NM_007365
Protein Refseq NP_031391
MIM 607935
UniProt ID Q9Y2J8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PADI2 Products

Required fields are marked with *

My Review for All PADI2 Products

Required fields are marked with *

0
cart-icon
0
compare icon