Recombinant Human PERP Full Length Transmembrane protein, His-SUMO & Myc-tagged

Cat.No. : PERP-2451H
Product Overview : Recombinant Human PERP protein(Q96FX8)(1-193aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 1-193aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 41.4kDa
AA Sequence : MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name PERP PERP, TP53 apoptosis effector [ Homo sapiens ]
Official Symbol PERP
Synonyms PERP; PERP, TP53 apoptosis effector; p53 apoptosis effector related to PMP-22; dJ496H19.1; KCP1; KRTCAP1; PIGPC1; THW; KCP-1; 1110017A08Rik; transmembrane protein THW; p53-induced protein PIGPC1; keratinocyte-associated protein 1; keratinocytes associated protein 1; p53 apoptosis effector related to PMP22; RP3-496H19.1;
Gene ID 64065
mRNA Refseq NM_022121
Protein Refseq NP_071404
MIM 609301
UniProt ID Q96FX8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PERP Products

Required fields are marked with *

My Review for All PERP Products

Required fields are marked with *

0
cart-icon
0
compare icon