Recombinant Human PERP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PERP-4053H
Product Overview : PERP MS Standard C13 and N15-labeled recombinant protein (NP_071404) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : PERP (P53 Apoptosis Effector Related To PMP22) is a Protein Coding gene. Diseases associated with PERP include Palmoplantar Keratoderma, Mutilating, With Periorificial Keratotic Plaques and Ankyloblepharon-Ectodermal Defects-Cleft Lip/Palate. Among its related pathways are Keratinization and TP53 Regulates Transcription of Cell Death Genes. An important paralog of this gene is TMEM47.
Molecular Mass : 21.4 kDa
AA Sequence : MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PERP p53 apoptosis effector related to PMP22 [ Homo sapiens (human) ]
Official Symbol PERP
Synonyms PERP; PERP, TP53 apoptosis effector; p53 apoptosis effector related to PMP-22; dJ496H19.1; KCP1; KRTCAP1; PIGPC1; THW; KCP-1; 1110017A08Rik; transmembrane protein THW; p53-induced protein PIGPC1; keratinocyte-associated protein 1; keratinocytes associated protein 1; p53 apoptosis effector related to PMP22; RP3-496H19.1;
Gene ID 64065
mRNA Refseq NM_022121
Protein Refseq NP_071404
MIM 609301
UniProt ID Q96FX8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PERP Products

Required fields are marked with *

My Review for All PERP Products

Required fields are marked with *

0
cart-icon
0
compare icon