Recombinant Human PERP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PERP-4053H |
Product Overview : | PERP MS Standard C13 and N15-labeled recombinant protein (NP_071404) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | PERP (P53 Apoptosis Effector Related To PMP22) is a Protein Coding gene. Diseases associated with PERP include Palmoplantar Keratoderma, Mutilating, With Periorificial Keratotic Plaques and Ankyloblepharon-Ectodermal Defects-Cleft Lip/Palate. Among its related pathways are Keratinization and TP53 Regulates Transcription of Cell Death Genes. An important paralog of this gene is TMEM47. |
Molecular Mass : | 21.4 kDa |
AA Sequence : | MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PERP p53 apoptosis effector related to PMP22 [ Homo sapiens (human) ] |
Official Symbol | PERP |
Synonyms | PERP; PERP, TP53 apoptosis effector; p53 apoptosis effector related to PMP-22; dJ496H19.1; KCP1; KRTCAP1; PIGPC1; THW; KCP-1; 1110017A08Rik; transmembrane protein THW; p53-induced protein PIGPC1; keratinocyte-associated protein 1; keratinocytes associated protein 1; p53 apoptosis effector related to PMP22; RP3-496H19.1; |
Gene ID | 64065 |
mRNA Refseq | NM_022121 |
Protein Refseq | NP_071404 |
MIM | 609301 |
UniProt ID | Q96FX8 |
◆ Recombinant Proteins | ||
PERP-1647H | Recombinant Human PERP, GST-tagged | +Inquiry |
PERP-5076C | Recombinant Chicken PERP | +Inquiry |
PERP-12638M | Recombinant Mouse PERP Protein | +Inquiry |
PERP-2451H | Recombinant Human PERP Full Length Transmembrane protein, His-SUMO & Myc-tagged | +Inquiry |
Perp-4794M | Recombinant Mouse Perp Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PERP-478HCL | Recombinant Human PERP lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PERP Products
Required fields are marked with *
My Review for All PERP Products
Required fields are marked with *
0
Inquiry Basket