Recombinant Human PEX19, His-tagged

Cat.No. : PEX19-27601TH
Product Overview : Recombinant full length Human PEX19 with an N terminal His tag; 316aa, 34.6kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 296 amino acids
Description : This gene is necessary for early peroxisomal biogenesis. It acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. These disorders have at least 14 complementation groups, with more than one phenotype being observed for some complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of Zellweger syndrome (ZWS), as well as peroxisome biogenesis disorder complementation group 14 (PBD-CG14), which is also known as PBD-CGJ. Alternative splicing results in multiple transcript variants.
Conjugation : HIS
Molecular Weight : 34.600kDa inclusive of tags
Tissue specificity : Ubiquitously expressed. Isoform 1 is strongly predominant in all tissues except in utero where isoform 2 is the main form.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:10% Glycerol, 0.32% Tris HCl
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQC
Sequence Similarities : Belongs to the peroxin-19 family.
Gene Name PEX19 peroxisomal biogenesis factor 19 [ Homo sapiens ]
Official Symbol PEX19
Synonyms PEX19; peroxisomal biogenesis factor 19; peroxisomal farnesylated protein , PXF; D1S2223E; HK33; housekeeping gene; 33kD; PMP1; PMPI; PXMP1;
Gene ID 5824
mRNA Refseq NM_001193644
Protein Refseq NP_001180573
Uniprot ID P40855
Chromosome Location 1q22
Pathway ABC-family proteins mediated transport, organism-specific biosystem; ABCA transporters in lipid homeostasis, organism-specific biosystem; Peroxisome, organism-specific biosystem; Peroxisome, conserved biosystem; Transmembrane transport of small molecules, organism-specific biosystem;
Function protein N-terminus binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PEX19 Products

Required fields are marked with *

My Review for All PEX19 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon