Recombinant Human PEX26 protein, GST-tagged
| Cat.No. : | PEX26-301326H |
| Product Overview : | Recombinant Human PEX26 (1-246 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-His246 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLDFRAALETCERAWQSLANHAVAEEPAGTSLEVKCSLCVVGIQALAEMDRWQEVLSWVLQYYQVPEKLPPKVLELCILLYSKMQEPGAVLDVVGAWLQDPANQNLPEYGALAEFHVQRVLLPLGCLSEAEELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHKFLSLPMLVRQLWDSAVSH |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | PEX26 peroxisomal biogenesis factor 26 [ Homo sapiens ] |
| Official Symbol | PEX26 |
| Synonyms | PEX26; peroxisomal biogenesis factor 26; peroxisome biogenesis factor 26; peroxisome assembly protein 26; FLJ20695; peroxin-26; peroxisome biogenesis disorder, complementation group 8; peroxisome biogenesis disorder, complementation group A; PEX26M1T; Pex26pM1T; |
| Gene ID | 55670 |
| mRNA Refseq | NM_001127649 |
| Protein Refseq | NP_001121121 |
| UniProt ID | Q7Z412 |
| ◆ Recombinant Proteins | ||
| PEX26-6649M | Recombinant Mouse PEX26 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PEX26-10289Z | Recombinant Zebrafish PEX26 | +Inquiry |
| PEX26-1933H | Recombinant Human PEX26 Protein, His&GST-tagged | +Inquiry |
| PEX26-525C | Recombinant Cynomolgus Monkey PEX26 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PEX26-3376R | Recombinant Rhesus monkey PEX26 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PEX26-3287HCL | Recombinant Human PEX26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PEX26 Products
Required fields are marked with *
My Review for All PEX26 Products
Required fields are marked with *
