Recombinant Human PFDN1 protein, GST-tagged
| Cat.No. : | PFDN1-5167H |
| Product Overview : | Recombinant Human PFDN1 protein(1-122 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-122 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | PFDN1 prefoldin subunit 1 [ Homo sapiens ] |
| Official Symbol | PFDN1 |
| Synonyms | PFDN1; prefoldin subunit 1; prefoldin 1; PFD1; PDF; |
| Gene ID | 5201 |
| mRNA Refseq | NM_002622 |
| Protein Refseq | NP_002613 |
| MIM | 604897 |
| UniProt ID | O60925 |
| ◆ Recombinant Proteins | ||
| Pfdn1-4806M | Recombinant Mouse Pfdn1 Protein, Myc/DDK-tagged | +Inquiry |
| PFDN1-3379R | Recombinant Rhesus monkey PFDN1 Protein, His-tagged | +Inquiry |
| PFDN1-2128Z | Recombinant Zebrafish PFDN1 | +Inquiry |
| Pfdn1-1009M | Recombinant Mouse PFDN1 protein(Met1-Gln122), His-tagged | +Inquiry |
| PFDN1-8030H | Recombinant Human PFDN1 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PFDN1-3281HCL | Recombinant Human PFDN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFDN1 Products
Required fields are marked with *
My Review for All PFDN1 Products
Required fields are marked with *
