Recombinant Human PFKFB3 protein, His-tagged

Cat.No. : PFKFB3-3284H
Product Overview : Recombinant Human PFKFB3 protein(243-520 aa), fused to His tag, was expressed in E. coli.
Availability November 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 243-520 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : HVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 [ Homo sapiens ]
Official Symbol PFKFB3
Synonyms PFKFB3; 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3; 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3; iPFK-2; PFK/FBPase 3; 6PF-2-K/Fru-2,6-P2ase 3; renal carcinoma antigen NY-REN-56; 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme; 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase; 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase; fructose-6-phosphate,2-kinase/fructose-2, 6-bisphosphatase; inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase; PFK2; IPFK2; FLJ37326;
Gene ID 5209
mRNA Refseq NM_001145443
Protein Refseq NP_001138915
MIM 605319
UniProt ID Q16875

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PFKFB3 Products

Required fields are marked with *

My Review for All PFKFB3 Products

Required fields are marked with *

0
cart-icon
0
compare icon