Recombinant Human PFKFB3 protein, His-tagged
| Cat.No. : | PFKFB3-3284H |
| Product Overview : | Recombinant Human PFKFB3 protein(243-520 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | September 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 243-520 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | HVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 [ Homo sapiens ] |
| Official Symbol | PFKFB3 |
| Synonyms | PFKFB3; 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3; 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3; iPFK-2; PFK/FBPase 3; 6PF-2-K/Fru-2,6-P2ase 3; renal carcinoma antigen NY-REN-56; 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme; 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase; 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase; fructose-6-phosphate,2-kinase/fructose-2, 6-bisphosphatase; inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase; PFK2; IPFK2; FLJ37326; |
| Gene ID | 5209 |
| mRNA Refseq | NM_001145443 |
| Protein Refseq | NP_001138915 |
| MIM | 605319 |
| UniProt ID | Q16875 |
| ◆ Recombinant Proteins | ||
| PFKFB3-24H | Active Recombinant Human PFKFB3 protein, His-tagged | +Inquiry |
| PFKFB3-4052R | Recombinant Rat PFKFB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PFKFB3-12572Z | Recombinant Zebrafish PFKFB3 | +Inquiry |
| PFKFB3-518H | Active Recombinant Human PFKFB3 Protein, His & GST-tagged | +Inquiry |
| PFKFB3-215H | Recombinant Human PFKFB3, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PFKFB3-471HCL | Recombinant Human PFKFB3 cell lysate | +Inquiry |
| PFKFB3-489HKCL | Human PFKFB3 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFKFB3 Products
Required fields are marked with *
My Review for All PFKFB3 Products
Required fields are marked with *
