Recombinant Human PFKFB3 protein, His-tagged
Cat.No. : | PFKFB3-3284H |
Product Overview : | Recombinant Human PFKFB3 protein(243-520 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 243-520 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | HVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 [ Homo sapiens ] |
Official Symbol | PFKFB3 |
Synonyms | PFKFB3; 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3; 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3; iPFK-2; PFK/FBPase 3; 6PF-2-K/Fru-2,6-P2ase 3; renal carcinoma antigen NY-REN-56; 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme; 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase; 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase; fructose-6-phosphate,2-kinase/fructose-2, 6-bisphosphatase; inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase; PFK2; IPFK2; FLJ37326; |
Gene ID | 5209 |
mRNA Refseq | NM_001145443 |
Protein Refseq | NP_001138915 |
MIM | 605319 |
UniProt ID | Q16875 |
◆ Recombinant Proteins | ||
PFKFB3-3284H | Recombinant Human PFKFB3 protein, His-tagged | +Inquiry |
PFKFB3-24H | Active Recombinant Human PFKFB3 protein, His-tagged | +Inquiry |
PFKFB3-82912TH | Recombinant Human PFKFB3, GST-tagged | +Inquiry |
PFKFB3-4052R | Recombinant Rat PFKFB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PFKFB3-12572Z | Recombinant Zebrafish PFKFB3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFKFB3-471HCL | Recombinant Human PFKFB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PFKFB3 Products
Required fields are marked with *
My Review for All PFKFB3 Products
Required fields are marked with *
0
Inquiry Basket