Recombinant Human PFN2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PFN2-5918H
Product Overview : PFN2 MS Standard C13 and N15-labeled recombinant protein (NP_444252) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene.
Molecular Mass : 15 kDa
AA Sequence : MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PFN2 profilin 2 [ Homo sapiens (human) ]
Official Symbol PFN2
Synonyms PFN2; profilin 2; profilin-2; profilin II; PFL; D3S1319E;
Gene ID 5217
mRNA Refseq NM_053024
Protein Refseq NP_444252
MIM 176590
UniProt ID P35080

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PFN2 Products

Required fields are marked with *

My Review for All PFN2 Products

Required fields are marked with *

0
cart-icon