Recombinant Human PFN2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PFN2-5918H |
Product Overview : | PFN2 MS Standard C13 and N15-labeled recombinant protein (NP_444252) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. |
Molecular Mass : | 15 kDa |
AA Sequence : | MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PFN2 profilin 2 [ Homo sapiens (human) ] |
Official Symbol | PFN2 |
Synonyms | PFN2; profilin 2; profilin-2; profilin II; PFL; D3S1319E; |
Gene ID | 5217 |
mRNA Refseq | NM_053024 |
Protein Refseq | NP_444252 |
MIM | 176590 |
UniProt ID | P35080 |
◆ Recombinant Proteins | ||
PFN2-12668M | Recombinant Mouse PFN2 Protein | +Inquiry |
PFN2-4397R | Recombinant Rat PFN2 Protein | +Inquiry |
PFN2-784C | Recombinant Cynomolgus PFN2 Protein, His-tagged | +Inquiry |
PFN2-528C | Recombinant Cynomolgus Monkey PFN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PFN2-332H | Recombinant Human PFN2, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFN2-3268HCL | Recombinant Human PFN2 293 Cell Lysate | +Inquiry |
PFN2-3267HCL | Recombinant Human PFN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFN2 Products
Required fields are marked with *
My Review for All PFN2 Products
Required fields are marked with *
0
Inquiry Basket