Recombinant Human PFN2 protein, T7-tagged

Cat.No. : PFN2-140H
Product Overview : Recombinant human PFN2 (140 aa, Isoform-1) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 140 a.a.
Form : 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYL RDSGF
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro ROCK1 pathway regulation study with intracellular protein delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping PFN2 protein-protein interaction.4. As potential diagnostic biomarker for bipolar disorder diseases.5. As antigen for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name PFN2 profilin 2 [ Homo sapiens ]
Official Symbol PFN2
Synonyms PFN2; profilin 2; profilin-2; profilin II; PFL; D3S1319E;
Gene ID 5217
mRNA Refseq NM_002628
Protein Refseq NP_002619
MIM 176590
UniProt ID P35080
Chromosome Location 3q25.1
Pathway Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, conserved biosystem; Salmonella infection, organism-specific biosystem; Salmonella infection, conserved biosystem; Shigellosis, organism-specific biosystem;
Function actin binding; phosphatidylinositol-4,5-bisphosphate binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PFN2 Products

Required fields are marked with *

My Review for All PFN2 Products

Required fields are marked with *

0
cart-icon