Recombinant Human PFN2 protein, T7-tagged
Cat.No. : | PFN2-140H |
Product Overview : | Recombinant human PFN2 (140 aa, Isoform-1) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 140 a.a. |
Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYL RDSGF |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro ROCK1 pathway regulation study with intracellular protein delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping PFN2 protein-protein interaction.4. As potential diagnostic biomarker for bipolar disorder diseases.5. As antigen for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | PFN2 profilin 2 [ Homo sapiens ] |
Official Symbol | PFN2 |
Synonyms | PFN2; profilin 2; profilin-2; profilin II; PFL; D3S1319E; |
Gene ID | 5217 |
mRNA Refseq | NM_002628 |
Protein Refseq | NP_002619 |
MIM | 176590 |
UniProt ID | P35080 |
Chromosome Location | 3q25.1 |
Pathway | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, conserved biosystem; Salmonella infection, organism-specific biosystem; Salmonella infection, conserved biosystem; Shigellosis, organism-specific biosystem; |
Function | actin binding; phosphatidylinositol-4,5-bisphosphate binding; protein binding; |
◆ Recombinant Proteins | ||
PFN2-644H | Recombinant Human PFN2 Protein | +Inquiry |
PFN2-30344TH | Recombinant Human PFN2, His-tagged | +Inquiry |
PFN2-2228H | Recombinant Human PFN2 protein, His-tagged | +Inquiry |
PFN2-12668M | Recombinant Mouse PFN2 Protein | +Inquiry |
PFN2-4874H | Recombinant Human PFN2 Protein (Met1-Phe140) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFN2-3268HCL | Recombinant Human PFN2 293 Cell Lysate | +Inquiry |
PFN2-3267HCL | Recombinant Human PFN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFN2 Products
Required fields are marked with *
My Review for All PFN2 Products
Required fields are marked with *
0
Inquiry Basket