Recombinant Human PFN2 protein, T7-tagged

• Cat.No.: PFN2-140H
• Product Overview: Recombinant human PFN2 (140 aa, Isoform-1) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 140 a.a.
• Form: 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYL RDSGF
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro ROCK1 pathway regulation study with intracellular protein delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping PFN2 protein-protein interaction.4. As potential diagnostic biomarker for bipolar disorder diseases.5. As antigen for specific antibody production.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: PFN2 profilin 2 [ Homo sapiens ]
• Official Symbol: PFN2
• Synonyms: PFN2; profilin 2; profilin-2; profilin II; PFL; D3S1319E
• Gene ID: 5217
• mRNA Refseq: NM_002628
• Protein Refseq: NP_002619
• MIM: 176590
• UniProt ID: P35080
• Chromosome Location: 3q25.1
• Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, conserved biosystem; Salmonella infection, organism-specific biosystem; Salmonella infection, conserved biosystem; Shigellosis, organism-specific biosystem
• Function: actin binding; phosphatidylinositol-4,5-bisphosphate binding; protein binding