Recombinant Human PFN2 protein, T7-tagged
| Cat.No. : | PFN2-140H |
| Product Overview : | Recombinant human PFN2 (140 aa, Isoform-1) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 140 a.a. |
| Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGEFMAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYL RDSGF |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro ROCK1 pathway regulation study with intracellular protein delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping PFN2 protein-protein interaction.4. As potential diagnostic biomarker for bipolar disorder diseases.5. As antigen for specific antibody production. |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | PFN2 profilin 2 [ Homo sapiens ] |
| Official Symbol | PFN2 |
| Synonyms | PFN2; profilin 2; profilin-2; profilin II; PFL; D3S1319E; |
| Gene ID | 5217 |
| mRNA Refseq | NM_002628 |
| Protein Refseq | NP_002619 |
| MIM | 176590 |
| UniProt ID | P35080 |
| Chromosome Location | 3q25.1 |
| Pathway | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, conserved biosystem; Salmonella infection, organism-specific biosystem; Salmonella infection, conserved biosystem; Shigellosis, organism-specific biosystem; |
| Function | actin binding; phosphatidylinositol-4,5-bisphosphate binding; protein binding; |
| ◆ Recombinant Proteins | ||
| PFN2-2729H | Recombinant Human PFN2 protein(11-130 aa), N-MBP & C-His-tagged | +Inquiry |
| PFN2-30344TH | Recombinant Human PFN2, His-tagged | +Inquiry |
| PFN2-11482Z | Recombinant Zebrafish PFN2 | +Inquiry |
| Pfn2-4813M | Recombinant Mouse Pfn2 Protein, Myc/DDK-tagged | +Inquiry |
| PFN2-2228H | Recombinant Human PFN2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PFN2-3268HCL | Recombinant Human PFN2 293 Cell Lysate | +Inquiry |
| PFN2-3267HCL | Recombinant Human PFN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFN2 Products
Required fields are marked with *
My Review for All PFN2 Products
Required fields are marked with *



