Recombinant Human PGC protein, GST-tagged
Cat.No. : | PGC-1164H |
Product Overview : | Recombinant Human PGC protein(1-90 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-90 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIGTPPQNFLVLF |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | PGC progastricsin (pepsinogen C) [ Homo sapiens ] |
Official Symbol | PGC |
Synonyms | PGC; progastricsin (pepsinogen C); gastricsin; pepsin C; pepsinogen C; preprogastricsin; pepsinogen group II; PEPC; PGII; FLJ99563; |
mRNA Refseq | NM_001166424 |
Protein Refseq | NP_001159896 |
MIM | 169740 |
UniProt ID | P20142 |
Gene ID | 5225 |
◆ Recombinant Proteins | ||
PGC-12681M | Recombinant Mouse PGC Protein | +Inquiry |
PGC-0041H | Recombinant Human PGC Protein | +Inquiry |
PGC-1663H | Recombinant Human PGC protein, His-tagged | +Inquiry |
PGC-4404R | Recombinant Rat PGC Protein | +Inquiry |
Pgc-144R | Recombinant Rat Pgc Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PGC-8318H | Native Human PGC | +Inquiry |
PGC-132H | Native Human Pepsinogen II | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGC-1705RCL | Recombinant Rat PGC cell lysate | +Inquiry |
PGC-2169HCL | Recombinant Human PGC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGC Products
Required fields are marked with *
My Review for All PGC Products
Required fields are marked with *
0
Inquiry Basket