Recombinant Human PGC protein, GST-tagged
| Cat.No. : | PGC-1164H |
| Product Overview : | Recombinant Human PGC protein(1-90 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-90 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIGTPPQNFLVLF |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | PGC progastricsin (pepsinogen C) [ Homo sapiens ] |
| Official Symbol | PGC |
| Synonyms | PGC; progastricsin (pepsinogen C); gastricsin; pepsin C; pepsinogen C; preprogastricsin; pepsinogen group II; PEPC; PGII; FLJ99563; |
| mRNA Refseq | NM_001166424 |
| Protein Refseq | NP_001159896 |
| MIM | 169740 |
| UniProt ID | P20142 |
| Gene ID | 5225 |
| ◆ Recombinant Proteins | ||
| Pgc-438M | Recombinant Mouse Pgc Protein, MYC/DDK-tagged | +Inquiry |
| PGC-12681M | Recombinant Mouse PGC Protein | +Inquiry |
| PGC-6662M | Recombinant Mouse PGC Protein, His (Fc)-Avi-tagged | +Inquiry |
| Pgc-2538R | Recombinant Rat Pgc protein, His-tagged | +Inquiry |
| PGC-142H | Recombinant Human PGC Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PGC-8318H | Native Human PGC | +Inquiry |
| PGC-132H | Native Human Pepsinogen II | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PGC-2169HCL | Recombinant Human PGC cell lysate | +Inquiry |
| PGC-1705RCL | Recombinant Rat PGC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGC Products
Required fields are marked with *
My Review for All PGC Products
Required fields are marked with *



