Recombinant Human PGF protein, hFc-tagged
| Cat.No. : | PGF-4635H |
| Product Overview : | Recombinant Human PGF protein(P49763)(19-170aa), fused with C-terminal hFc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 19-170aa |
| Tag : | C-hFc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 45.1 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR |
| Gene Name | PGF placental growth factor [ Homo sapiens ] |
| Official Symbol | PGF |
| Synonyms | PGF; placental growth factor; PGFL, placental growth factor, vascular endothelial growth factor related protein , placental growth factor like; placenta growth factor; D12S1900; PlGF; PLGF; PlGF 2; SHGC 10760; placental growth factor-like; placental growth factor, vascular endothelial growth factor-related protein; PGFL; PlGF-2; SHGC-10760; |
| Gene ID | 5228 |
| mRNA Refseq | NM_001207012 |
| Protein Refseq | NP_001193941 |
| MIM | 601121 |
| UniProt ID | P49763 |
| ◆ Recombinant Proteins | ||
| PGF-2583H | Recombinant Human PGF Protein, His-tagged | +Inquiry |
| PGF-100H | Active Recombinant Human PGF Protein | +Inquiry |
| Pgf-54M | Recombinant Mouse Pgf protein, His-tagged | +Inquiry |
| PGF-1619C | Recombinant Cynomolgus PGF protein, His-tagged | +Inquiry |
| PGF-770H | Active Recombinant Human PGF protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PGF-1118MCL | Recombinant Mouse PGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGF Products
Required fields are marked with *
My Review for All PGF Products
Required fields are marked with *




